SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012037 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012037
Domain Number 1 Region: 43-142
Classification Level Classification E-value
Superfamily Cystatin/monellin 1.56e-27
Family Cystatins 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012037   Gene: ENSPPYG00000010773   Transcript: ENSPPYT00000012512
Sequence length 147
Comment pep:known_by_projection chromosome:PPYG2:20:18773304:18776845:-1 gene:ENSPPYG00000010773 transcript:ENSPPYT00000012512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLPWKRGLPWALLLLLLGSQLLLIHAWHFHEQRDCDEHDVMARYLPATVEFAVHTFNQ
QSKDYYAYRLMHILNSWKEQVESKTVFSMELLLGRTRCGKFEDDIDNCPFQESTELNDTF
TCFFTISTRPWRTQFSLLNKTCLEGFH
Download sequence
Identical sequences H2P178
ENSPPYP00000012037 ENSPPYP00000012037 9600.ENSPPYP00000012037 XP_002830071.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]