SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012109 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012109
Domain Number 1 Region: 142-459
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.05e-121
Family Transglutaminase core 0.0000000000108
Further Details:      
 
Domain Number 2 Region: 2-138
Classification Level Classification E-value
Superfamily E set domains 3.01e-43
Family Transglutaminase N-terminal domain 0.000000286
Further Details:      
 
Domain Number 3 Region: 482-594
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.83e-31
Family Transglutaminase, two C-terminal domains 0.000000654
Further Details:      
 
Domain Number 4 Region: 594-692
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.11e-26
Family Transglutaminase, two C-terminal domains 0.00000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012109   Gene: ENSPPYG00000010843   Transcript: ENSPPYT00000012587
Sequence length 693
Comment pep:known_by_projection chromosome:PPYG2:20:25989620:26031406:-1 gene:ENSPPYG00000010843 transcript:ENSPPYT00000012587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGVQSVKWQTAFNRQAHHTDKFSSQELILRRGQNFQILMIMNKGLDSNERLEFIVST
GPYPSESAMTKAVFPLSNGSSGGWSAVLQASNGNTLTISISSPASAPVGRYTMALQIFSQ
GGVSSVKLGTFILLFNPWLNVDSVFMGNHAEREEYVQEDAGIIYVGSTNRIGMIGWNFGQ
FEEDILSICLSILDRSLNFRRDAATDVARRNDPKYVGRVLSAMINSNDDNGVLAGNWSGT
YTGGRDPRNWNGSVEILKNWKKSGFSPVRYGQCWVFAGTLNTALRSLGIPSRVITNFNSA
HDTDRNLSVDVYYDPMGNPLDKGSDSVWNFHVWNEGWFVRSDLGPAYGGWQVLDATPQER
SQGVFQCGPASVIGVREGDVQLNFDMPFIFAEVNADRITWLYDDTTGKQRKNSVNSHAIG
RYISTKAVGSNARMDVTEKYKYPEGSDQERQVFQKALGKLKPNASFGATSSMGLETEEQE
PSIIGKLKVAGMLAVGKEVNLVLLLKNLSRDTKTVTVNMTAWTIIYNGTLVHEVWKDSAT
MSLDPEEEAEHPIKISYAQYEKYLKSDNMIRITAVCKVPDESEVVVERDIILDNPTLTLE
VLNEARVRKPVNVQMLFSNPLDEPVRDCVLMVEGSGLLLGTLKIDVPTLRPKERSRVRFE
ILPTRSGTKQLLADFSCNKFPAIKAMLSIDVAE
Download sequence
Identical sequences H2P1F0
XP_002830165.1.23681 ENSPPYP00000012109 9600.ENSPPYP00000012109 ENSPPYP00000012109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]