SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012162 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012162
Domain Number 1 Region: 68-113
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012162   Gene: ENSPPYG00000010889   Transcript: ENSPPYT00000012641
Sequence length 155
Comment pep:known_by_projection chromosome:PPYG2:20:28800256:28801922:1 gene:ENSPPYG00000010889 transcript:ENSPPYT00000012641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVASGSAAAAAAGPSCALKAGKTAGGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG
RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Download sequence
Identical sequences H2P1K1
ENSPPYP00000012162 ENSPPYP00000012162 9600.ENSPPYP00000012162 XP_002830228.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]