SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012206 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012206
Domain Number 1 Region: 311-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.59e-16
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 573-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000028
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 3 Region: 485-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000588
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 526-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000179
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000012206
Domain Number - Region: 433-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00056
Family Classic zinc finger, C2H2 0.062
Further Details:      
 
Domain Number - Region: 37-67
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00145
Family C2HC finger 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012206   Gene: ENSPPYG00000010930   Transcript: ENSPPYT00000012686
Sequence length 750
Comment pep:known_by_projection chromosome:PPYG2:20:30902320:30961950:1 gene:ENSPPYG00000010930 transcript:ENSPPYT00000012686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNQTVLAVQSLLDGQGAVPDPTGQSVNAPPAIQPLDDEDVFLCGKCKKQFNSLPAFMTH
KREQCQGNAPALATVSLATNSIYTPSAAPTAVQQAPTPANRQISTYITVPPSPLIQTLVQ
GNILVSDDVLMSAMSAFTSLDQPMPQGPPPVQSSLNMHSVPSYLTQPPPPPPPPPPLPPP
PPPQPPPPPSQSLGPPGRPNPGGNGVVEVYSAAAPLAGSGTVEIQALGMQPYPPLEVPNQ
CVEPPVYPTPTVYSPGKQGFKPKGPNPAAPMTSATGGTVATFDSPPMLKTRRAKGARGLP
EAAGKPKAQKLKCSYCDKSFTKNFDLQQHIRSHTGEKPFQCIACGRAFAQKSNVKKHMQT
HKVWPPGHSGGTVSRNSVTVQVMALNPSRQEDEENTGLGQPLPGVPQPQALSTAGEEEGD
KPEPKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQCVKCVNKYSTPEALEHHLQT
ATHNFPCPHCQKVFPCERYLRRHLPTHSSGGRFKEKPYKCSVCESAFNRKDKLKRHMLIH
EPFKKYKCPFSTHTGCSKEFNRPDKLKAHILSHSGMKLHKCALCSKSFSRRAHLAEHQRA
HTGNYKFRCAGCAKGFSRHKYLKDHRCRLGPQKDKDLQTRRPPQRRAAPRSCGSGGRKVV
TPLPDPLGLEELKDAGAGLVPEAVPGKPPFAEPDAVLSIVVGGAVGAEPELVVPGHAEGL
GSNLALAELQAGAEGPCAMLAVPVYIQASE
Download sequence
Identical sequences H2P1P3
ENSPPYP00000012206 9600.ENSPPYP00000012206 ENSPPYP00000012206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]