SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012278 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012278
Domain Number 1 Region: 146-462
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.81e-127
Family Transglutaminase core 0.00000000000844
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 8.05e-43
Family Transglutaminase N-terminal domain 0.000000263
Further Details:      
 
Domain Number 3 Region: 470-585
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.71e-33
Family Transglutaminase, two C-terminal domains 0.000000454
Further Details:      
 
Domain Number 4 Region: 586-686
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.23e-28
Family Transglutaminase, two C-terminal domains 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012278   Gene: ENSPPYG00000010993   Transcript: ENSPPYT00000012759
Sequence length 687
Comment pep:known_by_projection chromosome:PPYG2:20:35417422:35455659:-1 gene:ENSPPYG00000010993 transcript:ENSPPYT00000012759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDLVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPADAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNSWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPW
NFGQFEDGILDICLMLLDVNPKFLKNAGRDCSRRSSPIYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGISPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINHSL
IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEK
SVPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK
RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRIDLLPLHVG
LHKLVVNFESDKLKAVKGFRNVIIGPA
Download sequence
Identical sequences H2P1W1
ENSPPYP00000012278 ENSPPYP00000012278 XP_009231846.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]