SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012313 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012313
Domain Number 1 Region: 241-331
Classification Level Classification E-value
Superfamily HMG-box 7.46e-25
Family HMG-box 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012313   Gene: ENSPPYG00000011025   Transcript: ENSPPYT00000012794
Sequence length 515
Comment pep:known_by_projection chromosome:PPYG2:20:41370100:41494860:1 gene:ENSPPYG00000011025 transcript:ENSPPYT00000012794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQTRTEAVAGAFSRCLGFCGIRLGLLLLARRWCIAGVFPQKFDGDSAYVGMSDGNPELL
STSQTYNGQSENNEDYEIPPITPPNLPEPSLLHLGDHEASYHSLCHGLTPNGLLPAYSYQ
AMDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGRPGPLLGRPAMLASHMSAL
SQSQLISQMGIRSSIAHSSPSPPGSKSATPSPSSSTQEEESEVHFKISGEKRPSADPGKK
AKNPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPSATFGDVSKIVASMWDSLGEEQ
KQAYKRKTEAAKKEYLKALAAYRASLVSKSSPDQGETKSTQANPPAKMLPPKQPMYAMPG
LASFLTPSDLQAFRSGASPASLARTLGSKSLLPGLSASPPPPPSFPLSPTLHQQLSLPPH
AQGALLSPPVSMSPAPQPPVLPTPMALQVQLAMSPSPPGPQDFPHISEFPSSSGSCSPGP
SNPTSSGDWDSSYPSGECGIGTCSLLPRDKSLYLT
Download sequence
Identical sequences H2P1Z5
9600.ENSPPYP00000012313 ENSPPYP00000012313 ENSPPYP00000012313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]