SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012348 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012348
Domain Number 1 Region: 301-527
Classification Level Classification E-value
Superfamily vWA-like 1.17e-60
Family Integrin A (or I) domain 0.00035
Further Details:      
 
Domain Number 2 Region: 8-215
Classification Level Classification E-value
Superfamily vWA-like 8.21e-55
Family Integrin A (or I) domain 0.00027
Further Details:      
 
Domain Number 3 Region: 219-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000692
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 537-577
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000000785
Family Chicken cartilage matrix protein 0.0028
Further Details:      
 
Domain Number 5 Region: 254-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000044
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012348   Gene: ENSPPYG00000011052   Transcript: ENSPPYT00000012830
Sequence length 581
Comment pep:known chromosome:PPYG2:20:42820067:42832665:-1 gene:ENSPPYG00000011052 transcript:ENSPPYT00000012830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLLCWPLLLLLLQPWETQLQLAGPRCHTGPLDLVFVIDSSRSVRPFEFETMRQFLMGL
LRGLNVGPNATRVGVIQYSSQVQSVFPLRAFSRSEDMERAIRDLVPLAQGTMTGLAIQYA
MNVAFSVAEGARPPEERVPRVAVIVTDGRPQDRVAEVAAQARARGIEIYAVGVQRADVGS
LRAMASPPLDEHVFLVESFDLIQEFGLQFQSRLCAIDLCAEGTHGCEHHCVNSPGSYFCR
CQVGFVLQQDQRSCRAIDYCSFGNHSCQHECVSTPGGPQCHCREGHDLQPDGRSCQVQDL
CNGVDHGCEFQCVSEGLSYRCLCPEGRQLQADGKSCNRCREGHVDLVLLVDGSKSVRPQN
FELVKRFVNQIVDFLDVSPEGTRVGLVQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER
GTMTGLALRHMVEHSFSEAQGARPRALNVPRVGLVFTDGRSQDDISVWAARAKEEGIVMY
AVGVGKAVEAELREIASKPAELHVSYAPDFGTMTHLLENLRGSICPEEGISAGTELRSPC
ECESLVEFQGRTLGALESLTLNLAQLTARLEDLENQLANQK
Download sequence
Identical sequences A4K2V8
ENSPPYP00000012348 ENSPPYP00000012348 NP_001162037.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]