SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012385 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012385
Domain Number 1 Region: 567-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000444
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 1078-1128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000107
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 499-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000327
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 1033-1086
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000322
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 5 Region: 624-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000605
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 6 Region: 249-273,465-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000107
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 7 Region: 651-706
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000603
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012385   Gene: ENSPPYG00000011082   Transcript: ENSPPYT00000012868
Sequence length 1347
Comment pep:known_by_projection chromosome:PPYG2:20:43529429:43552867:-1 gene:ENSPPYG00000011082 transcript:ENSPPYT00000012868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEENEVESSSDAAPGPGRPEEPSESGLGVGTSEAVSADSSDAAAAPGRAEADDSGVGQSS
DRGSRSQEEVSESSSSADPLPNGYLPDSSSVSHGPVAGVTGGPPALVHSSALPDPNMLVS
DCTASSSDLGSAIDKIIESTIGPDLIQSCITVTSAEDGGAETTRYLILQGPDDGAPMTSP
MSSSTLAHSLAAIEALADGPTSTSTCLEPPEEEAQGRPSSPVQLPPASGAEEPDLQSLEA
MMEVVVVQQFKCKMCQYRSSTKATLLRHMRERHFRPVAAAAAAAGKKGRLRKWSTSTKTQ
EEEGQEEEDDDDIVDAGAIDDLEEDSDYNPAEDEPRGRQLRLQRPTPSTPRPRRRPGRPR
KLPRLEISDLPDGVEGEPLVSSQSGQSPPEPQDPEAPSSSGPGHLVAMGKVSRTPVEAGV
SQSDAENAAPSCLDEHDTPPRRRGRPSRRFLGKKYRKYYYKSPKPLLRPFLCRICGSRFL
SHEDLRFHVNSHEAGDPQLFKCLQCSYRSRRWSSLKEHMFNHVGSKPYKCDECSYTSVYR
KDVIRHAAVHSRDRKKRPDPTPKLSSFPCPVCGRVYPMQKRLTQHMKTHSTEKPHMCDKC
GKSFKKRYTFKMHLLTHIQAVANRRFKCEFCEFVCEDKKALLNHQLSHVSDKPFKCSFCP
YRTFREDFLLSHVAVKHTGAKPFACEYCHFSTRHKKNLRLHVRCRHASSFEEWGRRHPEE
PPSRRRPFFSLQQIEELKQQHSAAPGPPPSSPGPPEIPPEATPFQSSEAPSLLCPDTLGG
ATIIYQQGAEESTAMATQTALDLLLNMSAQRELGGTALQVAVVKSEDVEAGLASPGGQPS
PEGATPQVVTLHVAEPGGGAAAESQLGPPDLPQITLAPGPFGGTGYSVITAPPMEEGTSA
PGTPYSEEPPGEAAQAVVVSDTLKEAGTHYIMATDGTQLHHIELTADGSISFPSPDALAS
GAKWPLLQCGGLPRDGPEPPSPAKTHCIGDSQSSASPPPATSKALGLAVPPSPPSAATAA
SKKFSCKICAEAFPGRAEMESHKRAHAGPGAFKCPDCPFSACQWPEVRAHMAQHSSLRPH
QCSQCSFASKNKKDLRRHMLTHTKEKPFACHLCGQRFNRNGHLKFHIQRLHSPDGRKSGT
PTARAPTQTPTQTIILNSDDETLATLHTALQSSHGVLVPERLQQALGQEHIIVAQEQTVT
NQEEATYIQEITTADGQTVQHLVTSDNQVQYIISQDGVQHLLPQEYVVVPEGHHIQVQEG
QITHIQYEQGAPFLQESQIQYVPVSPGQQLVTQAQLEAAAHSAVTAVADAAMAQAQGLFG
TEEAVPEHIQQLQHQGIEYDVITLADD
Download sequence
Identical sequences H2P255
ENSPPYP00000012385 ENSPPYP00000012385 9600.ENSPPYP00000012385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]