SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012402 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012402
Domain Number 1 Region: 14-321,412-510
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.75e-57
Family LacY-like proton/sugar symporter 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012402   Gene: ENSPPYG00000011098   Transcript: ENSPPYT00000012887
Sequence length 541
Comment pep:known_by_projection chromosome:PPYG2:20:44348106:44359709:1 gene:ENSPPYG00000011098 transcript:ENSPPYT00000012887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGRPPSVLPLCASVSLLGGLTFGYELAVISGALLPLQLDFGLSCLEQEFLVGSLLLGALL
ASLVGGFLIDCYGRKQAILGSNLVLLAGSLTLGLAGSLAWLVLGRSVVGFAISLSSMACC
IYVSELVGPRQRGVLVSLYEAGITVGILLSYALNYALAGTPWGWRHMFGWATAPALLQSL
SLLFLPAGTDETAIHKDLIPLQGGEAPKLGPGRPRYSFLDLFRARDNMQSRTTVGLGLVL
FQQLTGQPNVLCYASTIFSSVGFHGGSSAVLASVGLGAVKVAATLTAMGLVDRAGRRALL
LAGCALMALSVSGIGLVSFAVPMDSGPSCLAVPNATGQTGLPGDSGLLQDSSLPPMPRTN
EDQKEPILSTAKKTKPHPRSGNPSAPPRPALSSALPGPPLPTQGHALLRWTALLCLMVFV
SAFSFGFGPVTWLVLSEIYPVEIRGRAFAFCNSFNWAANLFISLSFLDLIGTIGLSWTFL
LYGLTAVLGLGFIYLFVPETKGQSLAEIDQQFQKRRFALSFGHRQNSTGIQYSRIEVSAA
S
Download sequence
Identical sequences H2P272
9600.ENSPPYP00000012402 ENSPPYP00000012402 ENSPPYP00000012402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]