SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012428 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012428
Domain Number 1 Region: 193-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 151-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000123
Family Classic zinc finger, C2H2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012428   Gene: ENSPPYG00000011122   Transcript: ENSPPYT00000012916
Sequence length 263
Comment pep:known_by_projection chromosome:PPYG2:20:47706475:47712554:1 gene:ENSPPYG00000011122 transcript:ENSPPYT00000012916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVRKSSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLI
WDSVLAPQAQPIAWASLRPQESPRAAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSASS
LEAEAYAAFPGLGQVPKQLAQLSEAKDLQSRKAFNCKYCNKEYLSLGALKMHIRSHTLPC
VCGTCGKAFSRPWLLGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQAC
ARTFSRMSLLHKHQESGCSGCPR
Download sequence
Identical sequences H2P298
ENSPPYP00000012428 ENSPPYP00000012428 9600.ENSPPYP00000012428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]