SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012445 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012445
Domain Number 1 Region: 868-920
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 2 Region: 565-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000254
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 381-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000434
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 602-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000688
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012445   Gene: ENSPPYG00000011138   Transcript: ENSPPYT00000012933
Sequence length 1052
Comment pep:known_by_projection chromosome:PPYG2:20:49560923:49583878:-1 gene:ENSPPYG00000011138 transcript:ENSPPYT00000012933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQAKPQHINSEEDQGEQQPQQQTPEFADAAPAAPAAGELGAPVSHPGNDEVASEDE
AIVKRLRREETHICEKCCAEFFSISEFLEHKKNCTKNPPVLIMNDSEGPVPSEDFSGAVL
SHQPASPSSKDGHRENGGSSEDMKEKPGAESVVYLKTETALPSTPQDISYLAKGKVANTN
VTLQALRGTKVAVNQRSADALPAPVPGANSIPWVLEQILCLQQQQLQQIQLTEQIRIQVN
MWASHALHSSGAGADTLKTLGSHMSQQVSAAVALLSQKAGSQGLSLDALKQAKLPHANIP
SATSSLSPGLAPFALKPDGTRVLPNVMSRLPSALLPQAPGSVLFQSPFSTVALDTSKKGK
GKPPNISAVDVKPKDEAVLYKHKCKYCSKVFGTDSSLQIHLRSHTGERPFVCSVCGHRFT
TKGNLKVHFHRHPQVKANPQLFAEFQDKVAAGNGIPYALSVPDPIDEPSLSLDSKPVLVT
TSVGLPQNLSSGTNPKDLTGGPLPGDLQPGPSPESEGGPTLPGVGPNHNSPRAGGFQGSG
TPEPGSETLKLQQLVENIDKATTDPNECLICHRVLSCQSSLKMHYRTHTGERPFQCKICG
RAFSTKGNLKTHLGVHRTNTSIKTQHSCPICQKKFTNAVILQQHIRMHMGGQIPNTPLPE
NPCDLTGSEPMTVGENGSTGTICHDDVIESIDVEEISSQEAPGSSSKVPMPLPSIHSASP
TLGFAVMASLDAPGKVGPAPFNLQRQGSRENGSVESDGLTNDSSSLMGDQEYQSRSPDIL
ETTSFQALSPANSQAESIKSKSPDAGSKAESSENSRTEMEGRSSLPSTFIRAQPTYVKVE
VPGTFVGPSTLSPGMTPLLAAQPRRQAKQHGCTRCGKNFSSASALQIHERTHTGEKPFVC
NICGRAFTTKGNLKVHYMTHGANNNSARRGRKLAIENTMALLGTDGKRVSEIFPKEILAP
SVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSMDGSQS
GISADVEKPSATDGVSKHQFPHFLEENKIAVS
Download sequence
Identical sequences H2P2B5
ENSPPYP00000012445 9600.ENSPPYP00000012445 ENSPPYP00000012445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]