SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012446 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012446
Domain Number 1 Region: 145-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-17
Family Classic zinc finger, C2H2 0.0016
Further Details:      
 
Domain Number 2 Region: 300-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.49e-16
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 354-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.34e-16
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 4 Region: 392-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000762
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 5 Region: 185-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000879
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 6 Region: 505-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000574
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 7 Region: 477-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000293
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 8 Region: 552-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000439
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000012446
Domain Number - Region: 11-39
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000566
Family C2HC finger 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012446   Gene: ENSPPYG00000011139   Transcript: ENSPPYT00000012934
Sequence length 629
Comment pep:known_by_projection chromosome:PPYG2:20:49900111:50005495:-1 gene:ENSPPYG00000011139 transcript:ENSPPYT00000012934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGGTTVLVELTPDIHICGICKQQFNNLDAFVAHKQSGCQLTGTSAAAPSTVQFVSEETVP
ATQTQTTTRTITSETQTITVSAPEFVFEHGYQTYLPTESNENQTATVISLPAKSRTKKPT
TPPAQKRLNCCYPGCQFKTAYGMKDMERHLKIHTGDKPHKCEVCGKCFSRKDKLKTHMRC
HTGVKPYKCKTCDYAAADSSSLNKHLRIHSDERPFKCQICPYASRNSSQLTVHLRSHTAS
ELDDDVPKATCLSTESSDTRKAPVITLPSEAREQMATLGERTFNCCYPGCHFKTVHGMKD
LDRHLRIHTGDKPHKCEFCDKCFSRKDNLTMHMRCHTSVKPHKCHLCDYAAVDSSSLKKH
LRIHSDERPYKCQLCPYASRNSSQLTVHLRSHTGDTPFQCWLCSAKFKISSDLKRHMIVH
SGEKPFKCEFCDVRCTMKANLKSHIRIKHTFKCLHCAFQGRDRADLLEHSRLHQADHPEK
CPECSYSCSSAAALRVHSRVHCKDRPFKCDFCSFDTKRPSSLAKHIDKVHRDEAKTENRA
PLGKEGLRESSSQHMAKIVTQRAFRCETCGASFVRDDSLRCHKKQHSDQSENKNSDLVTF
PPESGASGQLSTLVSVGQLEAPLEPSQDL
Download sequence
Identical sequences H2P2B6
ENSPPYP00000012446 ENSPPYP00000012446 9600.ENSPPYP00000012446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]