SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012448 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012448
Domain Number 1 Region: 473-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000523
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 129-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000315
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 217-238,371-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000993
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000012448
Domain Number - Region: 60-90
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000832
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012448   Gene: ENSPPYG00000011140   Transcript: ENSPPYT00000012936
Sequence length 1048
Comment pep:known_by_projection chromosome:PPYG2:20:51389199:51405552:-1 gene:ENSPPYG00000011140 transcript:ENSPPYT00000012936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSKVTGNMPTQSLLMYMDGPEVIGSSLGSQMEMEDAMSMKGTAVVPFRATQEKNVIQIE
GYMPLDCMFCSQTFTHSEDLNKHVLMQHRPTLCEPAVLRVEAEYLSPLDKSQVRTEPPKE
KNCKENEEFSCEVCGQTFRVAFDVEIHMRTHKDSFTYGCNMCGRRFKEPWFLKNHMRTHN
GKSGSRGKLQQGLESPATINEVVQVHAAESISSPYKICMVCGFLFPNKESLIEHRKVHTK
KTAFGTSSAQTDSPQGGMPSSREDFLQLFNLRPKSHPETGKKPVRCIPQLDPFTTFQAWQ
LATKGKVAICQEEVKESGQEGSTDNDDSSSEKELGETNKGSCTGLSQEKEKCKHSHGEAP
SVDADPKLPSSKEKPTHCSECGKAFRTYHQLVLHSRVHKKDRRAGAESPTMSVDGRQPET
CSPDLAAPLDENGAVDRGEGGSEDGSEDGLPEGIHLDKNDDGGKIKHLTSSRECSYCGKF
FRSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHHKEKQTDVAAEVKNDGKN
QDTEDALLTADSAQTKNLKRFFDGAKDVTGSPPAKQLKEMPSVFQNVLGSAVLSPAHKDT
QDFHKNAADDSADKVNKNPTPAYLDLLKKRSAVETQANNLICRTKADVTPPPDGSTTHNL
EVSPKEKQTENAADCRYRPSVDCHEKPLNLSLGALHNCPAISLSKSLIPSICPFCSFKTF
YPEVLMMHQRLEHKYNPDVHKNCRNKSLLRSRRTGCPPALLGKDVPPLSSFCKPKPKSAF
PAQSKSLPSAKGKQSPPGPGKAPLTSGIDSSTLAPSNLKSHRPQQNVGVQGAATRQQQSE
MFPKTSVSPAPDKTKRPETKLKPLPVAPSQPALGSSNINGSIDFPAKSDSPWAPPGRDYF
CNRSASNTAAEFGEPLPKRLKSSVVALDVDQPGANYRRGYDLPKYHMVRGITSLLPQDCV
YPSQALPPKPRFLSSSEVDSPNVLTVQKPYGGSGPLYTCVPAGSPASSSTLEGKRPVSYQ
HLSNSMAQKRNYENFIGNAHYRPNDKKT
Download sequence
Identical sequences H2P2B8
9600.ENSPPYP00000012448 ENSPPYP00000012448 ENSPPYP00000012448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]