SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012558 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012558
Domain Number 1 Region: 1198-1505,1576-1673
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.6e-78
Family RNB domain-like 0.0000917
Further Details:      
 
Domain Number 2 Region: 2085-2175,2210-2561
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.06e-60
Family Tandem AAA-ATPase domain 0.064
Further Details:      
 
Domain Number 3 Region: 538-875
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.96e-26
Family Extended AAA-ATPase domain 0.049
Further Details:      
 
Domain Number 4 Region: 1063-1166,1199-1225
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000971
Family Cold shock DNA-binding domain-like 0.015
Further Details:      
 
Domain Number 5 Region: 33-73
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000393
Family HkH motif-containing C2H2 finger 0.083
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000012558
Domain Number - Region: 964-1038
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 0.0355
Family Tetrapyrrole methylase 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012558   Gene: ENSPPYG00000011241   Transcript: ENSPPYT00000013054
Sequence length 2587
Comment pep:known_by_projection chromosome:PPYG2:20:61969373:61984054:-1 gene:ENSPPYG00000011241 transcript:ENSPPYT00000013054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVWEAEQLGGLQRGDLLTPPAPDGDGRTAPLGQPPGAQLYCPACLVTCHSQEAFENHCA
SSEHAQMVAFDQAVPWEHRSPPPGLSKFELCPKPDLCEYGDACTKAHSARELQEWVQRTQ
AVELRGQAAWQDGLVPYQERLLAEYQRSSSEVLVLAETLDGVRVTCNQPLMYQAQERKTQ
YSWTFAVHSEEPLLHVALLKQEPGADFSLVAPGLPPGRLYARGERFRVPSSTADFQVGVR
VQAASFGTFEQWVVFDFGRRPVLLQKLGLQLGQGRRPGPCRNLALRHPEEMERWHTGNRH
VVPGVERTAEQTALMAKYKGPALALEFNRSGLASGPISPTNYRQRMHQFLYEEEAAQQQL
VAKLTLRGQVFLKTALQTPALNMLFAPPGALYAEVPIPSSLMPDTDQGFLLGRAVSTALV
APVPAPDNTVFEVRLERRASSEQVLWLLLPARCCLALGLQAEARLVLEVQFQIDPMTFRL
WHQAVDRLPEEQLVVPDLPTCALPRPWSVPPLRRGNRKQELAMALIAGWGPGDGRRVPPL
LIYGPFGTGKTYTLAMASLEVIRRPETKVLICTHTNSAADIYIREYFHSHVSDGHPEATP
LRVMYTDRPLSQTDPVTLQYCCLTDDRQAFRPPTWADLAQHRVVVTTTSQARELRVPVGF
FSHILIDEAAQMLECEALTPLRCTQTIFSFISRHFYVAKGNPIHSRGKVPPHPRHYPLMF
CHVPGNPDRDMSMASWLNLAEIVQAIEKVQEAYNTWPSCWGGREQRHICVVSHGAQVSAL
RQELRRRDLGQVSVGSFEILPGRQFRVVVLSTVHTCQSLLTPGALAPEFFTDARVLNTVL
TRAQSQLVVVGDAVALCSFGACGKLWESFIRECVERHSVCPEGLSMEQVEQGVAQRRRWP
LQGTRAGAAGNCEAAPEPVGDLAEEPAAVVTATVKAEPGDEALSPASRDITATTAQTEAA
AAPAGDAVEEDVVPGACAAGAAAAAGVESTEPEDADADFWPWDGELNADDAILRELLDES
QKVMVTVGEDGLLDTVARPESLRQARLYENLPPAALRKLLRAEPERYRHCTFVPETFERA
SAIPLDDASSGPIQVRGRLDCGMAFTGDEVLVQLLSGDRAPEGRLRGRVLGVLKRRRHEL
AFVCRMDTWDPRIMVPINGSVTKIFVAELKDPSQVPVYSLRKGRLQRVGLERLTAEARHS
RLFWVPIVLWRQGFYYPLGIVPEVLPEASTWEQGLRILDLEYSLRVPPSDLAAITKALQK
YHTELGQVAGRREDCRASLTFTVDPRGACNLDDALSVRDLGPRCEVAVHITDVASFVPRD
GVLDVEARRQGAAFYAPGREPVPMLPASLCQDILSLLPGRDRLAISLFLTMEKASGQLKS
LRFAPSVVRSDRQLSYEEAEEVIRQHPGAGRELPARLDSVDACVVAACYFSRLLRQHRLQ
SDCFYEQPDEDSTLGFRAAHIMVKEYMIQFNRLVAEFLVGSECTRTVTPLRWQPAPRSQQ
LKALCEKHGDRVPLSLHLGHHLHGGGGSPPDTRLHLLASLWKQVQFAARTQDYEQMVDLV
TTDDMHPFLAPAGRDLRKALERSTFGRCTRGHQQQGGHYSLQVDWYTWATSPIRRYLDVL
LQRQILLALGHGGSAYSARDIDGLCQAFSLQHALAQSYQRRARSLHLATQLKAQPLDKLG
FVVDVEAGSRCFRLLFPSNRETLPDPCPVPYGSLQLAEHPHALAGRPGLQLLWRRRVYSV
QGSSPPLPLPGTVLDPHTWAVETALWKQLLALVELQRWPEAAALIQEKGEASQRRELVQV
QRSRCGHFLEVAWELGSGDTLQVQLGASLQHGFLVPSPQLWTVAPGFSLCLEHVERPGDC
FSGRVYRAPRDRYRDVDEYACVWEPFCALESATGAVAENDSVTLQHLSVSWKASRTPQGQ
LQGAFPLEAAFVEENCADINFSCCYLCIRLEGLPAPTASPCPGPSSLGSGLNVDPGTYTW
VAHGQTEDWDQERRADRQEAPRRVHLFVHHVGMEKVPEEVLRPGTLFTVELLPKQLPDLR
KEEAVRGLEEASPLVTSIALGRPVPQPLCRVIPSRFLERQTYDIPGGCHKLNPSQNVAVR
EALEKPFTVIQGPPGTGKTIVGLHIVFWFHKSNQEQVQPGGPRRGEKRLGGPCILYCGPS
NKSVDVLAGLLLRRMELKPLRVYSEQAEASEFPVPRVGSRKLLRKSPREGRPNQSLRSIT
LHHRIRQAPNPYSSEIKAFDARLQRGELFSREDLVSYKKVLWEARKFELDRHEVILCTCS
CAASASLKTLDVRQILVDEAGMATEPETLIPLVQFPQAEKVVLLGDHKQLRPVVKNERLQ
NLGLDRSLFERYHEDAHMLDTQYRMHKGICAFPSVAFYKSRLKTWQGLRRPPSVLGHAGK
ESCPVIFGHVQGHERSLLVSTDEGNENSKANLEEVAEVVRITKQLTLGRTVEPQDIAVLT
PYNAQASEISKALRREGIAGVAVSSITKSQGSEWRYVLVSTVRTCAKSDLDQRPTKSWLK
KFLGFVVDPNQVNVAVTRAQEGLCLIGDHLLLRCCPLWRSLLDFCEAQQTLVPAGQVRVC
RRPTMPS
Download sequence
Identical sequences H2P2M4
ENSPPYP00000012558 9600.ENSPPYP00000012558 ENSPPYP00000012558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]