SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012566 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012566
Domain Number 1 Region: 9-126
Classification Level Classification E-value
Superfamily POZ domain 1.18e-30
Family BTB/POZ domain 0.00046
Further Details:      
 
Domain Number 2 Region: 429-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.25e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012566   Gene: ENSPPYG00000011247   Transcript: ENSPPYT00000013062
Sequence length 570
Comment pep:known_by_projection chromosome:PPYG2:20:62178411:62227005:-1 gene:ENSPPYG00000011247 transcript:ENSPPYT00000013062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNRKEDMEIASHYRHLLRELNEQRQHGVLCDVCVVVEGKVFKAHKNVLLGSSRYFKTLY
CQVQKTSEQATVTHLDIVTAQGFKAIIDFMYSAHLALTSRNVIEVMSAASFLQMTDIVQA
CHDFIKAALDISIKSDASDELAEFEIGASSSSSTEALISAVMAGRSISPWLARRTSPANS
SGDSAIASCHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGYGPLRIKEEQVSPSQYGG
SELPSAKDGAVQNSFSEQSVGDAWQPTGRRKNRKNKETVRHITQQVENDSRAGSPVPSFL
PTSGWPFSSRDSNADLSVTEASSSDSRGERAELYAQVEEGLLGGEASYLGPPLTPEKDDA
LHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPRGAHSLSLNEFTVIRKKFKC
PYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFTRREHMKRHTLVHSKDKKYLCKVCS
RVFMSAXXXHPPRLQRTMITPCPAPAGTQQGQEVHVQGVQPSLHVCRQRGHQAWLPAPRC
VHRLCWPRHGRAPGPWRRRWRGLSRGAVPR
Download sequence
Identical sequences H2P2N0
ENSPPYP00000012566 ENSPPYP00000012566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]