SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012625 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012625
Domain Number 1 Region: 136-313
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.44e-25
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0057
Further Details:      
 
Domain Number 2 Region: 86-130
Classification Level Classification E-value
Superfamily TGS-like 0.0000687
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012625   Gene: ENSPPYG00000011303   Transcript: ENSPPYT00000013125
Sequence length 338
Comment pep:known_by_projection chromosome:PPYG2:21:26055340:26077364:-1 gene:ENSPPYG00000011303 transcript:ENSPPYT00000013125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALAMGARALRLWRVAPGGGISWRFIATSPASQLSPTELTEMRNDLFNKEKARQLSLTP
RTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLT
KSCEIKFLTFKDRDPGEVNKAYWRSCAMIMGCVIERAFKDEYMVNLVRAPEVPVISGAFC
YDVVLDSKLDEWMPTKENLRSFTKDAHALIYKDLPFETLEVEAKVALEIFQHNKYKIDFI
EEKASQNPERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGV
SLPVHLRAHFTIWDKLLERSRKMVTEDQSKPTEECTST
Download sequence
Identical sequences H2P2T6
XP_002830624.1.23681 ENSPPYP00000012625 9600.ENSPPYP00000012625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]