SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012633 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012633
Domain Number 1 Region: 255-466
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.16e-53
Family Reprolysin-like 0.0018
Further Details:      
 
Domain Number 2 Region: 557-613
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000109
Family TSP-1 type 1 repeat 0.00029
Further Details:      
 
Domain Number 3 Region: 907-966
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000249
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 4 Region: 856-909
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000366
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012633   Gene: ENSPPYG00000011310   Transcript: ENSPPYT00000013133
Sequence length 970
Comment pep:known chromosome:PPYG2:21:27329279:27338746:-1 gene:ENSPPYG00000011310 transcript:ENSPPYT00000013133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRAVPEGFGRRKLGSDMGNAERAPGSRSFGPVPTLLLLAAALLAVSDALGRPSEEDEEL
VVPELERAPGHWTTRLRLHAFDQQLDLELRPDSSFLAPGFTLQNVGRKSGSETPLPEPDL
AHCFYSGTVNGDPSSAAALSLCEGVRGAFYLLGEAYFIQPLPAASERLATAAPGEKPPAP
LQFHLLRRNRQGDGGGTCGVVDDELRPTAKAETEDEDQGTEDKDERAQWSPQDPALQRVG
QPTGTGSIRKKRFVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRN
SVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQD
LCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASL
NGVNQDSHMMASMLSNLDHIQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPGDLPGT
SYDANRQCQFTFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWC
INGKCVNKTDRKHFDTPFHGSWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEG
KRVRYRSCNLEDCPDNNGKTFREEQCEAHNEFSKASFGSGPAVEWIPKYAGVSPKDRCKL
ICQAKGIGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAGCDHIIDSKKKFDKCGVCGGN
GSTCKKISGSVTSAKPGYHDIITIPTGATNIEVKQRNQRGSRNNGSFLAIKAADGTYILN
GDYTLSTLEQDIMYKGVVLRYSGSSAALERIRSFSPLKEPLTIQVLTVGNALRPKIKYTY
FVKKKKESFNAIPTFSAWIIEEWGECSKSCELGWQTRLVECRDMNGQPASECAKEVKPAS
TRPCADHPCPQWQLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHENCDPLKKPKHFIDF
CTMAECSEVV
Download sequence
Identical sequences H2P2U3
ENSPPYP00000012633 ENSPPYP00000012633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]