SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012731 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012731
Domain Number 1 Region: 230-334
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.06e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 88-191
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000262
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.054
Further Details:      
 
Domain Number 3 Region: 5-52
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000759
Family HLH, helix-loop-helix DNA-binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012731   Gene: ENSPPYG00000011405   Transcript: ENSPPYT00000013237
Sequence length 525
Comment pep:known_by_projection chromosome:PPYG2:21:37798202:37845224:1 gene:ENSPPYG00000011405 transcript:ENSPPYT00000013237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRAVFPEGL
GDAWGQPSRAGPLDSVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPSDHDEMTAVLTAHQPLHHHLLQEYEIERSFFLRMKCVLAKRNAGLTCSGY
KVIHCSGYLKIRQYMLDMSLYDSCYQIVGLVAVGQSLPPSAITEIKLYSNMFMFRASLDL
KLIFLDSRVTEVTGYEPQDLIEKTLYHHVHGCDVFHLRYAHHLLLVKGQVTTKYYRLLSK
RGGWVWVQSYATVVHNSRSSRPHCIVSVNYVLTEIEYKELQLSLVQVSTAKSQDSWRTAL
STSQETRKLAKPKNTKMKTKLRTNPYPPQQYSSFQMDKLECGQLGNWRASPPASTPAPPE
PQLHSESSELLYAPSYSLPLSYHYGHLPLDSHVFSSKKPMLPAKFGQPQGSPCEVARFFL
STLPASGECQWHYANPLVPSSSSPAKNPPEPPANTARHSLVPSYE
Download sequence
Identical sequences H2P340
9600.ENSPPYP00000012731 ENSPPYP00000012731 ENSPPYP00000012731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]