SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012774 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012774
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily POZ domain 2.75e-25
Family BTB/POZ domain 0.00078
Further Details:      
 
Domain Number 2 Region: 728-767
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.28e-20
Family Classic zinc finger, C2H2 0.00099
Further Details:      
 
Domain Number 3 Region: 864-914
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000077
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 543-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000103
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 5 Region: 669-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000163
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000012774
Domain Number - Region: 972-1020
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000398
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012774   Gene: ENSPPYG00000011443   Transcript: ENSPPYT00000013288
Sequence length 1021
Comment pep:known_by_projection chromosome:PPYG2:21:43213216:43216723:-1 gene:ENSPPYG00000011443 transcript:ENSPPYT00000013288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLLHYINPAHAISLLSALNEERLKGQLCDVLLIVGDQKFRAHKNVLAASSEYFQSLFT
NKENESQTVFQLDFCEPDAFDNVLNYIYSSSLFVEKSSLAAVQELGYSLGISFLTNIVSK
TPQAPFPTCPNRKKVFVEDDENSSQKRSVIVCQSRNEAQGKTVSQNQPDVSHTSRPSPSI
AAKANTNKPHVPKPIEPLHNLSLTEKSWPKDSSVVYAKSLEHSGSLDDPNRISLVKRNAV
LPSKPLQDREAMDDKPGVSGQLPKGKALELALKRPRPPVLSLCSSSETPYLLKETNKGNG
QGEDRNLLYYSKLGLVIPSSGSGSGNQSIDRSGPLVKSLLRRSLSMDSQVPVYSPSIDLK
SSQGSSSVSNDAPGNVLCALSQKSSLKDCSEKTALDDRPQVLQPHRLRSFSASQSTDRQG
ASPVTEVRIKTEPSSPLSDPSDIIRVTVGDAAATAAASSSLVTRDLSLKTEDDQKDMSRL
PAKRRFQADRRLPFKKLKVNEHGSPVSEDNFEEGSSPTLLDADFPDSDLNKDEFGELEGT
RPNKKFKCKHCLKIFRSTAGLHRHVNMYHNPEKPYACDICHKRFHTNFKVWTHCQTQHGI
VKNPSPASSSHAVLDEKFQRKLIDIVREREIKKALIIKLRRGKPGFQGQSSSQAQQVIKR
NLRSRAKGAYICTYCGKAYRFLSQFKQHIKMHPGEKPLGVNKVLCNAAVCYCSRFSPELK
QHESKCEYKKLTCLECMRTFKSSFSIWRHQEVHNQNNMAPTENFSLPVLDHNGDVTGSSR
PQSQPEPNKVNHVVTTKDDNVFSDSSEQVNFDSEDSSCLPEDLSLSKQLKIQVKEEPVEE
AEEEAPEASTAPKEAGPSKEASLWPCEKCGKMFTVHKQLERHQELLCSVKPFICHVCNKA
FRTNFRLWSHFQSHMSQASEESAHKESEVCPVPTNSPSPPPLPPPPPLPKIQPLEPDSPT
GLSENPTPATEKLFVPQESDTLFYHAPPLSAITFKRQFMCKLCHRTFKTAFSLWSHEQTH
N
Download sequence
Identical sequences H2P380
ENSPPYP00000012774 ENSPPYP00000012774 9600.ENSPPYP00000012774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]