SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012821 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012821
Domain Number 1 Region: 8-352
Classification Level Classification E-value
Superfamily Phosphofructokinase 9.42e-107
Family Phosphofructokinase 0.000000252
Further Details:      
 
Domain Number 2 Region: 340-691
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.96e-84
Family Phosphofructokinase 0.0000416
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012821   Gene: ENSPPYG00000011483   Transcript: ENSPPYT00000013337
Sequence length 697
Comment pep:known chromosome:PPYG2:21:45815786:45841959:1 gene:ENSPPYG00000011483 transcript:ENSPPYT00000013337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVDLEKLRASGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIHEGYEGLVE
GGENIKQANWLSVSNIIQLGGTVIGSARCKAFTTREGRRAAAYNLVQHGITNLCVIGGDG
SLTGANIFRSEWGSLLEELVAEGKISETMARTYSHLNIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRVLSSKMAMEAVMALLEATPDTPACVVTLSGNQSVRLPLMECVQMTKEVQK
AMDDKRFDEAIQLRGGSFENNWNIYKLLAHQKPPKEKSNFSLAILNVGAPAAGMNAAVRS
AVRTGISHGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGQLESI
VENIRIYGIHALLVVGGFEVLDGIAYMHEARGTRECPCPSAGAVPGLCPRVPGTPLPTHS
QCVCRPLSTSCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFNI
HDLKVNVEHMTEKMKTDIQRGLVLRNEKCHDYYTTEFLYNLYSSEGKGVFDCRTNVLGHL
QQGGAPTPFDRNYGTKLGVKAMLWLSEKLRDVYRKGR
Download sequence
Identical sequences H2P3C7
9600.ENSPPYP00000012821 ENSPPYP00000012821 ENSPPYP00000012821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]