SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012842 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000012842
Domain Number - Region: 24-49
Classification Level Classification E-value
Superfamily Plexin repeat 0.00837
Family Plexin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012842   Gene: ENSPPYG00000011504   Transcript: ENSPPYT00000013360
Sequence length 91
Comment pep:known_by_projection chromosome:PPYG2:21:46396998:46417864:-1 gene:ENSPPYG00000011504 transcript:ENSPPYT00000013360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLVLRVLKKACYQQGSGRGPSFACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLP
PASLCKLSSARWGVCWGLFKEENPYARFENN
Download sequence
Identical sequences H2P3E8
ENSPPYP00000012842 ENSPPYP00000012842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]