SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013000 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013000
Domain Number 1 Region: 420-878
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.11e-117
Family PIWI domain 0.00075
Further Details:      
 
Domain Number 2 Region: 122-442
Classification Level Classification E-value
Superfamily PAZ domain 1.33e-75
Family PAZ domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013000   Gene: ENSPPYG00000011653   Transcript: ENSPPYT00000013529
Sequence length 878
Comment pep:known_by_projection chromosome:PPYG2:22:19691354:19736184:-1 gene:ENSPPYG00000011653 transcript:ENSPPYT00000013529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRARTRARGRARRRESYQQEAPGGPRAPGSATTQEPAQLQSTPWPLWEEVPVVRPLQP
RGARGGAQSQGVKEPGPEAVLPTAPLQERRIGGVFQDLVVNTRRDMKHVKDSKTGSEGTV
VQLLANHFRVISRPQWVAYKYNVDYKPDIEDGNLRTILLDQHRRKFGERHIFDGNSLLLS
RPLKERSVEWLSTTKDKKFVKITVEFSKELTPTSPDCLRYYNILFRRTFKLLGFEQVGRN
YYTKKKAIQLYRHGTSLEIWLGYVTSILQYENSITLCADVSHKLLRIETAYDFIKRTSAQ
AQTGNIREEVTNKLIGSIVLTKYNNKTYRVDDIDWKQNPEDTFNKSDGSKISYIDYYRQQ
HKEIVTVKKQPLLVSQGRWKKGLMGTQREPILLIPQLCHMTGLTDEIRKDYSIMKELAKH
TRLSPRRRHHTLKEFINTIQDNKKVRELLQLWDLKFDTNFLSVPGRVLKNANIVQGRRMV
KANSQGDWSREIRELPLLNAVPLHSWLILYSRSSHREAMSLKGHLQSVTAPMGITMKPAE
MIEVDGDANSYIDTLRKYTRPTLQMGMSCLLVFKVICILPNDDKRRYDSIKRYLCTKCPI
PSQCVVKKTLEKVQARTIVTKIAQQMNCKMGGALWKVETDVQRTMFVGIDCFHDIVNRQK
SIAGFVASTNAELTKWYSQCVIQKTGEELVKELQICLKAALDVWCKNESSMPHSVIVYRD
GVGDGQLQALLDHEAKKMSTYLKTISPNHFTLAFIVVKKRINTRFFLKHGSDFQNPPPGT
VIDLELTRNEWYDFFIVSQSVQDGTVTPTHYNVIYDTIGLSPDTVQRLTYCLCHMYYNLP
GIIRVPAPCHYAHKLAYLVGQSIHQEPNRSLSTRLFYL
Download sequence
Identical sequences H2P3V3
9600.ENSPPYP00000013000 XP_002830989.1.23681 ENSPPYP00000012999 ENSPPYP00000012999 ENSPPYP00000013000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]