SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013174 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013174
Domain Number 1 Region: 87-177
Classification Level Classification E-value
Superfamily HMG-box 4.71e-28
Family HMG-box 0.0000531
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013174   Gene: ENSPPYG00000011810   Transcript: ENSPPYT00000013711
Sequence length 436
Comment pep:known_by_projection chromosome:PPYG2:22:33152341:33163248:-1 gene:ENSPPYG00000011810 transcript:ENSPPYT00000013711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEQDLSEVELSPVGSEEPRCLSPGSAPSLGPDGGGGGSGKLRTSPGPGELGKVKKEQQ
DGEADDDKFPVCIREAVSQVLSGYDWTLVPMPVRVNGASKSKPHVKRPMNAFMVWAQAAR
RKLAGQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRK
NGKAAQGEAECPGGEAEQGGTAALQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPP
TPPTTPKTELQSGKADPKRDGRSMGEGGKPHIDFGNVDIGEISHEVMSNMETFDVAESSE
HFAIFKPPGGALSTVSSPGVDSKAQLKFETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGS
AFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSH
SPTHWEQPVYTTLSRP
Download sequence
Identical sequences H2P4C4
ENSPPYP00000013174 ENSPPYP00000013174 9600.ENSPPYP00000013174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]