SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013253 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013253
Domain Number 1 Region: 34-253
Classification Level Classification E-value
Superfamily vWA-like 5.4e-62
Family Ku70 subunit N-terminal domain 0.00000000275
Further Details:      
 
Domain Number 2 Region: 254-479
Classification Level Classification E-value
Superfamily SPOC domain-like 2.55e-61
Family Ku70 subunit middle domain 0.00000000341
Further Details:      
 
Domain Number 3 Region: 506-554
Classification Level Classification E-value
Superfamily SAP domain 0.000000000000549
Family SAP domain 0.0000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013253   Gene: ENSPPYG00000011876   Transcript: ENSPPYT00000013792
Sequence length 555
Comment pep:known_by_projection chromosome:PPYG2:22:36887612:36931893:1 gene:ENSPPYG00000011876 transcript:ENSPPYT00000013792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSENELTPF
DMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELD
QFKGQQGQKRFQELMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDS
AKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLE
DLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKT
RTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHH
YLRPSLFVYPEESLVIGFQLVFLPFADDKRKMPFTEKIMATPEQVDKMKAIVEKLRFTYR
SDSFENPVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDY
NPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGL
KKQELLEALTKHFQD
Download sequence
Identical sequences H2P4K1
ENSPPYP00000013253 ENSPPYP00000013253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]