SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013258 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013258
Domain Number 1 Region: 432-502
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.22e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013258   Gene: ENSPPYG00000011880   Transcript: ENSPPYT00000013797
Sequence length 1058
Comment pep:known_by_projection chromosome:PPYG2:22:37104034:37176134:1 gene:ENSPPYG00000011880 transcript:ENSPPYT00000013797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRHHPTRRLARRLAEMSLVPLTTNRGARCLEAGPQGARARAGESRPALSVRRPGATQTW
RRVEPVGEAVPGGGCRVSWAVATAPPPRLPEQHGRGASALSRAMDESGELGGLETMETLT
ELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGSGGSGSSSSSSGGSSSSSGSN
GRGSSSGAVDPSMQRSFTQVTLPSFSPSAASPQAPTLQVKVSPTSVPPTPRATPVLQPRP
QPQPQPQAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAATSFQVLQPQVQSLVTSSQVQ
PVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVLVQPQIIKTDSLVL
TTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSSGTILTTMPVMMGQEKVPIKQ
VPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDAKMHKSGVLRKAID
YIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPA
SDSGSQAGFSPYSIDSEPGSPLLDDAKVHGEPVIRPHSRSSVTFWRHRKQADLDLARKLP
AGSACSDVHMALCAVNLAECAEEKIPPSTLVEIHLTAAMGLKTRCGGKLGFLASYFLSRA
QSLCGPEHSAVPDSLRWLCHPLGQKFFMERSWSVKSAAKESLYCAQRNPADPIAQVHQAF
CKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDSVGIVTPPLSSSSV
LKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFTKVESVPKALEVTESPLVKAVFHA
CRAMHASLPGKADGQQSSFCHCERASGHLWSSLNVSGATSDPVLNHVVQLLTCDLLLSLR
TTLWQKQASASQAVGETYHASGAELAGFQRDLGSLRRLAHSFRPAYRKVFLHEATVRLMA
GASPTRTHQLLEHSLRRRTTQSTKHGEVDAWPGQRERATAILLACRHLPLSFLSSPGQRA
VLLAEAARTLEKVGDRRSCNDCQQMIVKLGGGTAIAAS
Download sequence
Identical sequences H2P4K6
ENSPPYP00000013258 ENSPPYP00000013258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]