SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013351 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013351
Domain Number 1 Region: 719-1166
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.12e-52
Family Hermes transposase-like 0.006
Further Details:      
 
Domain Number 2 Region: 459-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000428
Family BED zinc finger 0.027
Further Details:      
 
Domain Number 3 Region: 288-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000559
Family BED zinc finger 0.072
Further Details:      
 
Domain Number 4 Region: 118-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000309
Family BED zinc finger 0.081
Further Details:      
 
Domain Number 5 Region: 561-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000476
Family Classic zinc finger, C2H2 0.078
Further Details:      
 
Domain Number 6 Region: 655-714
Classification Level Classification E-value
Superfamily Hermes dimerisation domain 0.000000314
Family Hermes dimerisation domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013351   Gene: ENSPPYG00000011967   Transcript: ENSPPYT00000013896
Sequence length 1171
Comment pep:known_by_projection chromosome:PPYG2:22:45516822:45520337:1 gene:ENSPPYG00000011967 transcript:ENSPPYT00000013896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENNLKTCPKEDGDFVSDKIKFKIEEEDDDGIPPDSLERMDFKSEQEDMKQTDSGGERAG
LGGTGCSCKPPGKYLSAESGDDYGTLFSQYSSTLYDVAMEAVTQSLLSSRNMSSRKKSPA
WKHFFISPRDSTKAICMYCVKEFSRGKNEKDLSTSCLMRHVRRAHPTVLIQENGSVSAVS
SFPSPSLLLPPQPADAGDLSTILSPIKLVQKVASKIPSPDRITEESVSVVSSEEISSDMS
VSEKCGREEALVGSSPHLPALHYDEPAENLAEKSLPLPKSTSGSRRRSAVWKHFYLSPLD
NSKAVCIHCMNEFSRGKNGKDLGTSCLIRHMWRAHRAIVLQENGGTGIPPLYSTPPTLLP
SLLPPEGELSSVSSSPVKPVRESPSASSSPDRLTEDLQSHLNPGDGLMEDAAAFSSSDDV
GEASASSPEKQQADGLSPRLFESGAVFQQNKKVMKRLKSEVWHHFSLAPMDSLKAECRYC
GCAISRGKKGDVGTSCLMRHLYRRHPEVVGSQKGFLGASLANSPYATLASAESSSSKLTD
LPTVVTKNNQVMFPVNSKKTSKLWNHFSICSADSTKVVCLHCGRTISRGKKPTNLGTSCL
LRHLQRFHSNVLKTEVSETARPSSPDIRVPRGTELSGASSFDDTNEKFYDSHPVAKKITS
LIAEMIALDLQPYSFVDSVGFNRLLEYLKPQYSLPAPSYFSRTAIPGMYDNVKQIIMSHL
KEAESGVIHFTSGIWMSNQTREYLTLTAHWVSFESSARPRCDDHHCSALLDVSQVDCDYS
GNSIQKQLECWWEAWVTSTGLQVGITVTDNPSIGKTLSEGEHSSVQCFSHTVNLIVSEAI
KSQRMVQNLLSLARKICERVHRSPKAKEKLAELQREYALPQHHLIQDVPSKWSTSFHMLE
RLIEQKRAINEMSVECNFRELISCDQWEVMQSVCRALKPFEAASREMSTQMSTLSQVIPM
VHILNRKVEMLFEETMGIDTMLRCLKEAMVSRLSATLHDPRYVFATLLDPRYKASLFTEE
EAEQYKQDLIRELELMNSTSEDVAASHRCDAGSPSKDSAAEENLWSLVAKVKKKDPREKL
PEDMVLAYLEEEVLEHSCDPLTYWNLKKPSWPGLSALAVRFLGCPPSIVPSEKLFNTPTE
NGSLGQSRLMMEHFEKLIFLKVNLPLIYFQY
Download sequence
Identical sequences H2P4U6
9600.ENSPPYP00000013351 ENSPPYP00000013351 XP_002831328.1.23681 ENSPPYP00000013351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]