SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013434 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013434
Domain Number 1 Region: 4-99
Classification Level Classification E-value
Superfamily Globin-like 0.00000000000000105
Family Globins 0.00000567
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013434   Gene: ENSPPYG00000012049   Transcript: ENSPPYT00000013983
Sequence length 99
Comment pep:known chromosome:PPYG2:22_random:3461455:3465545:-1 gene:ENSPPYG00000012049 transcript:ENSPPYT00000013983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEMKASDLKKHGATVLILLGGILKKKGHHAEIKPLAQSHATKHKIPVKYLEFISESIIQV
LQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Download sequence
Identical sequences H2P527
ENSPPYP00000013434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]