SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013446 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000013446
Domain Number - Region: 294-393
Classification Level Classification E-value
Superfamily Tropomyosin 0.000199
Family Tropomyosin 0.01
Further Details:      
 
Domain Number - Region: 195-264
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0392
Family Myosin rod fragments 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013446   Gene: ENSPPYG00000012059   Transcript: ENSPPYT00000013995
Sequence length 402
Comment pep:novel chromosome:PPYG2:2a:4015363:4041964:-1 gene:ENSPPYG00000012059 transcript:ENSPPYT00000013995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDEIARLRLEIDTIKNQNLEKKHLKYFENVKRKHEDLQKALKRNGETLAKTITCYSGQL
AALTDENTTLRSKLEKQRESRQRLETEMQSYRCRLNAALCDHEQSHSSERDQELAFQGTV
DKWCHLQENLNSRVLILSQQLSKAGSKSRVLETELHYTREALKEKALVFEHVQSELKQKQ
SQMKDIEKMYKSGYNTMENCIEKQERFCQLKKQNMLLQQQLDDARNKADNQEKAILNIQA
RCDARVQNLQAECRKRRLLLEEENKRLVNELNHSKEKERQYEKEKAEREVAVRQLQQKRD
DVLNKQSATKALLDASSRHCIYLENEMQDSRKKLDQMRNQFQEIQDQLTATIRCTKEMEG
DAQKLEVENAMMRKMIKTQDDQIEQLAKILQRSSLMLQVFKS
Download sequence
Identical sequences H2P538
ENSPPYP00000013446 ENSPPYP00000013446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]