SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013471 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013471
Domain Number 1 Region: 509-659
Classification Level Classification E-value
Superfamily vWA-like 1.17e-20
Family Integrin A (or I) domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000013471
Domain Number - Region: 1034-1084
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0196
Family Tudor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013471   Gene: ENSPPYG00000012082   Transcript: ENSPPYT00000014020
Sequence length 1294
Comment pep:known_by_projection chromosome:PPYG2:2a:5596082:5825741:1 gene:ENSPPYG00000012082 transcript:ENSPPYT00000014020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKSGSSSTISEQQLQRQEGWSNTKTDLAEQSLISSEKWLQLHGLKSNKLTLKQILSQIG
FPHCEDYVASLGRPVASRYADGLFPQLCRAEDGRVYNLTAKSELIYQFVEHLTQAVESYK
QRMDWLTSKSRQIFGVILEQCVTIVLDFGGILEGELDLCREALTMVLQEQVAHITKFNII
RVSQEPVKWQENATPVTKQSIATAVSWVEKLMVELTVSEAGRLDALLEAGRDKTIESIYY
FVVGDVPEESKELLLQRALEIPCPVYTVSFNARGEGTIAFLKDLSAKTHSRFHAFAERTE
CVEFPAFSTKDGDDVTTWNSRKLKGKLPPGAGVREDVFLVWREMEEACSTLAQIQRLVAE
PPKPDVATVDCESETTSVEIASNPEDTWDSKTWLQKYGLKAQKLSLYDVLADCSFRHADG
VVDIKAKPENESVQTSAETNKKTVHAKYCSRFVHALWKDGSLVHVNITKEKCKWYSERIH
TALAQIRRRIKWLQDGSQSLFGRLHNDCIYILIDTSHSMKSKLDLVKDKIIQFIQEQLKY
KSKFNFVKFDGQAVAWREQLAEVNEDSLEQAQSWIRDMKIGSSTNTLSALKTAFADKETQ
AIYLLTDGRPDQPPETVIDQVKLFQEIPIYTISFNYNDEIANRFLKEVAALTGGEFHFYN
FGCKDPTPPEAVQNEDLTLLVKEMEQGYRDLEKMQDLYSESLIMDWWYNAEKDGDSKHQK
EICSMISTPEKCAKPQSDVDSTQTSSLNMLKGPWGLSDQKVQKKKVLHAESTKTSLLRSQ
MSSLRSSACSERKDGLSNASSRRTALSDKEMSILLAEEWLDDKSSEKVTREGSQVYDHHS
SDVSSENWLKTYGLVAKKLTLMDALSVAAVPHSSTYVPVLDKHVMSKVFDEVFPLAHVCK
DTNKMTLINPQGAKLNIYKQKVEQAIQSYEKHLNKIVWRALSQEEKEKLDANKPIQYLEN
KTVLNQALERLNWPISLKELSMLESEILAGKMYIQQAMELQEAAKKNYGDKAPGEQQKLQ
GNPTKKTKSKRPDPLKGQKVIARCDENGFYFPGVVKKCVSRTQALVGFSYGDTKVVSTSF
IMPVGGAMPCPLLQVGDYVFAKIAIPKGFDFYVPAIVIALPNKHVATEKFYTVLKCNNRR
EFCPRSALIKISQNKYALSCSHIKSLPIPEDPEVEDVEARNSAFLFRPLKEADTQDSREP
RREKPRRKKRPAKQPLQQAAPSDSDGSSHGTSSHGSCRGTHPEPKTAHLHFPAAGRLGLS
SHAIIATPPPRAALPCTLQATHSSKGLRSVPETP
Download sequence
Identical sequences H2P562
9600.ENSPPYP00000013471 ENSPPYP00000013471 ENSPPYP00000013471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]