SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013482 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013482
Domain Number 1 Region: 22-194
Classification Level Classification E-value
Superfamily Lysozyme-like 0.000000000000149
Family G-type lysozyme 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013482   Gene: ENSPPYG00000012093   Transcript: ENSPPYT00000014031
Sequence length 194
Comment pep:known_by_projection chromosome:PPYG2:2a:6869798:6890999:-1 gene:ENSPPYG00000012093 transcript:ENSPPYT00000014031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALWLLLGLLALMDLSESSNWGCYGNIQTLDTPGASCGTGRCHGLNYCGVRASETLAEI
DMPYLLKYQPTMQTIGQKYCVDPAVIAPVLSRKSPGDKILVNMGDRTSMVQDPGSHAPTS
WISESQVSQMTEVLTTRIKEIQRRFPTWTPDQYLRGGLCAYSGDGGYVGSSQDLSCEFCN
DVLARAKYLRRHGF
Download sequence
Identical sequences H2P572
XP_009234675.1.23681 XP_009234679.1.23681 XP_009234682.1.23681 XP_009234687.1.23681 XP_009234690.1.23681 XP_009234698.1.23681 ENSPPYP00000013482 ENSPPYP00000013482 9600.ENSPPYP00000013482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]