SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013592 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013592
Domain Number 1 Region: 24-116
Classification Level Classification E-value
Superfamily Immunoglobulin 5.66e-39
Family V set domains (antibody variable domain-like) 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013592   Gene: ENSPPYG00000012191   Transcript: ENSPPYT00000014147
Sequence length 118
Comment pep:novel chromosome:PPYG2:2a:21727615:21812401:1 gene:ENSPPYG00000012191 transcript:ENSPPYT00000014147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMRVPTQLLGLLLLWLPGSRCDIQMTQSPSSLSASVGDRVTITCRASQSISSWLAWYQQ
KPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHNSYPP
Download sequence
Identical sequences H2P5I1
ENSPPYP00000013592 ENSPPYP00000013592 9600.ENSPPYP00000013592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]