SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013628 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013628
Domain Number 1 Region: 229-288
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.02e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013628   Gene: ENSPPYG00000012219   Transcript: ENSPPYT00000014183
Sequence length 321
Comment pep:known_by_projection chromosome:PPYG2:2a:24364396:24400080:-1 gene:ENSPPYG00000012219 transcript:ENSPPYT00000014183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGL
RDRTHRLQPVPVPVPVPVPVAPAVPPRGGTDTAGERGGSRAPEVSDARKRGFALGAVGPG
LHTPPPPPPPAPQSQAPGGPEAQPFREPGLRPRIFLCAPPARPAPSAPPAPPAPPESTVR
PAPPTRPGESSYSSISHVIYNNHPDSSASPRKRQGEATAASSEIKALQQTRRLLANARER
TRVHTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLARLADLDYSADHSNLSFS
ECVQRCTRTLQAEGRAKKRKE
Download sequence
Identical sequences H2P5L5
9600.ENSPPYP00000013628 ENSPPYP00000013628 ENSPPYP00000013628 XP_002811868.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]