SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013643 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013643
Domain Number 1 Region: 65-368,535-569
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.05e-46
Family FAD-linked reductases, N-terminal domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013643   Gene: ENSPPYG00000012233   Transcript: ENSPPYT00000014198
Sequence length 610
Comment pep:known_by_projection chromosome:PPYG2:2a:24818732:24840125:1 gene:ENSPPYG00000012233 transcript:ENSPPYT00000014198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLPLVLLLAVLLLAVLCKVYLGLFSGSSPNPFSEDVKRPPAPLVTDKEARKKVLKQAFS
ANRVPEKLDVVVIGSGFGGLAAAAILAKAGKRVLVLEQHTKAGGCCHTFGKNGLEFDTGI
HYIGRMEEGSTGRFILDQITEGQLDWAPLSSPFDIMVLEGPNGRKEYPMYSGEKAYIQGL
KEKFPQEEAIIDKYIKLVKVVSSGAPHAILLKFLPLPVVQLLNRCGLLTRFSPFLQASTQ
SLAEVLQQLGASSELQAVLSYIFPTYGVTPSHSAFSMHALLVNHYMEGGFYPRGGSSEIA
FHTIPVIQRAGGAVLTKATVQSVLLDSAGKACGVSVKKGHELVNIYCPIVVSNAGLFNTY
EHLLPGNARCLPGVKQQLGTVQPGLGMTSVFIGLQGTKEDLHLPSTNYYVYYDTDMDQAM
ERYVSMPREEAAEHIPLLFIAFPSAKDPTWEDRFPGRSTMIILIPTAYEWFEEWQAELKG
KRGSDYETFKNSFVEASMSVVLKLFPQLEGKVESVTAGSPLTNQFYLAAPRGACYGADHD
LGRLHPRVMASLRAQSPITNLYLTGQDIFTCGLLGALQGALLCSSAILKRNLYSDLKDLD
SRIRAQKKKN
Download sequence
Identical sequences H2P5M8
9600.ENSPPYP00000013643 XP_009235408.1.23681 ENSPPYP00000013643 ENSPPYP00000013643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]