SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013672 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013672
Domain Number 1 Region: 43-324
Classification Level Classification E-value
Superfamily Sema domain 4.51e-71
Family Sema domain 0.00000366
Further Details:      
 
Domain Number 2 Region: 327-376
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000129
Family Plexin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013672   Gene: ENSPPYG00000012262   Transcript: ENSPPYT00000014230
Sequence length 585
Comment pep:known_by_projection chromosome:PPYG2:2a:36010476:36042528:-1 gene:ENSPPYG00000012262 transcript:ENSPPYT00000014230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPASAARPRPGPGQPTASPFPLLLLLAVLSGPVSGRVPRSVPRTSLPISEADSYLTRFAV
PHTYNYSVLLVDPASHTLYVGARDTIFALSLPFSEERPRKIDWMVPEAHRQNCRKKGKKE
DECHNFVQILAIANASHLLTCGTFAFDPKCGVIDVSRFQQVERLESGRGKCPFEPAQRSA
AVMAGGVLYAATVKNYLGTEPIITRAVGRAEDWIRTDTLPSWLNAPAFVAAVALSPAEWG
DEDGDDEIYFFFTETSRAFDSYERIKVPRVARVCADGHLHRAVRIGAQLSVEDLLFPEPQ
PVENMKLYQSWLLVGSRTEVTQVNTTNCGRLQSCSECILAQDPVCAWSFRLDECVAHVGE
HQGLVQDIESADVSSLCPKEPGERPVVFEVPVATAAHVVLPCSSSSAWASCVWHQPSGVT
ALTPRRDGLEVVVTPGAMGAYACECQEGGAARVVAAYSLVWGSQRDVPSRAHTVGVGLAG
FFLGVLAASLTLILIGRRQQRRRQRELLARDKVGLDLGAPPSGTTSYSQDPPSPSPEDER
LPLALAKRGSGFGGFSPPFLLDPCPSPAHIRLTGAPLATCDETSI
Download sequence
Identical sequences H2P5Q4
9600.ENSPPYP00000013672 ENSPPYP00000013672 ENSPPYP00000013672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]