SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013675 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013675
Domain Number 1 Region: 4-108
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00026
Further Details:      
 
Domain Number 2 Region: 331-445
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0014
Further Details:      
 
Domain Number 3 Region: 145-243
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0043
Further Details:      
 
Domain Number 4 Region: 264-327
Classification Level Classification E-value
Superfamily SRCR-like 5.49e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013675   Gene: ENSPPYG00000012265   Transcript: ENSPPYT00000014233
Sequence length 668
Comment pep:known_by_projection chromosome:PPYG2:2a:36145692:36167076:1 gene:ENSPPYG00000012265 transcript:ENSPPYT00000014233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLRFRLAGFPRKPYEGRVEIQRAGEWGTICDDDFTLQAAHVLCRELGFTEATGWTHSAKY
GPGTGRIWLDNLSCSGTEQSVTECASRGWGNSDCTHDEDAGVICKDQRLPGFSDSNVIEV
EHHLQVEEVRIRPAVGWGRRPLPVTEGLVEVRLPDGWSQVCDKGWSAHNSHVVCGMLGFP
SEKRVNAAFYRLLAQRQQHSFGLHGVACVGTEAHLSLCSLEFYRANDTARCPGGGPAVVS
CVPGPLYAASSGQKKQQQSKPQGEACVRLKGGAHPGEGRVEVLASTWGTVCDRKWDLHAA
SVCRELGFGSAREALSGARMGQGNLPYTGERIRLSGGRSQHEGRVEVQIGGPGPLRWGLI
CGDDWGTLEAMVACRQLGLGYANHGLQETWYWDSGNITEVVMSGVRCTGTELSLDQCAHH
GTHITCKRTETRFTAGVICSETASDLLLHSALVQETAYIEDRPLHMLYCAAEENCLASSA
RSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHSWVWHECHGHYHSMDIFTHYDILTPN
GTKVAEGHKASFCLEDTECQEDVSKRYECANFGEQGITVGCWDLYRHDIDCQWIDITDVK
PGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGHRIWVHNCHIGDAFSEEANRRFERYP
GQTSNQII
Download sequence
Identical sequences H2P5Q7
ENSPPYP00000013675 ENSPPYP00000013675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]