SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013761 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013761
Domain Number 1 Region: 417-780
Classification Level Classification E-value
Superfamily SIS domain 6.4e-103
Family double-SIS domain 0.000000388
Further Details:      
 
Domain Number 2 Region: 83-293,348-392
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.67e-52
Family Class II glutamine amidotransferases 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013761   Gene: ENSPPYG00000012340   Transcript: ENSPPYT00000014320
Sequence length 780
Comment pep:known_by_projection chromosome:PPYG2:2a:41452233:41514783:1 gene:ENSPPYG00000012340 transcript:ENSPPYT00000014320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPTGSGALRAEGRGPGGGLLAEPGEGGEGSRCLGRRHPPRGVVSAPPRSPSPQIAQRSS
CVHPRSRQPLASGLAGRVSGIMCGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAG
VGFDGGNDKDWEANACKIQLIKKKGKVKALDEEVHKQQDMDLDIEFDVHLGIAHTRWATH
GEPSPVNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYM
YDNRESQDTSFTTLVERVIQQLEGAFALVFKSVHFPGQAVGTRRGSPLLIGVRSEHKLST
DHIPILYRTARTQIGSKFTRWGSQGERGKDKKGSCNLSRVDSTTCLFPVEEKAVEYYFAS
DASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNF
SSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAG
VATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGA
LTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQE
RRKEIMLGLKRLPDMIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKE
ITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICD
KEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences H2P5Z1
ENSPPYP00000013761 ENSPPYP00000013761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]