SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014099 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014099
Domain Number 1 Region: 116-185
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000123
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014099   Gene: ENSPPYG00000012628   Transcript: ENSPPYT00000014670
Sequence length 193
Comment pep:known_by_projection chromosome:PPYG2:2a:94558785:94559366:-1 gene:ENSPPYG00000012628 transcript:ENSPPYT00000014670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNLRETFLSLEDGLGSSDSPGLLSSWDWKDRARPFELNQASPSQSLSPAPSLESYSSSS
CPAVAGLPCEHGRASSGGSDGCSVGGASGLVEVDYNMLAFQPTYLQGGGGPKAQKGTKVR
MSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTD
LLNRGREPRAQSA
Download sequence
Identical sequences H2P6W7
XP_002812317.2.23681 ENSPPYP00000014099 9600.ENSPPYP00000014099 ENSPPYP00000014099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]