SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014202 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014202
Domain Number 1 Region: 33-411
Classification Level Classification E-value
Superfamily Sema domain 1.15e-128
Family Sema domain 0.0000000504
Further Details:      
 
Domain Number 2 Region: 413-461
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000115
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 472-544
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000105
Family I set domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014202   Gene: ENSPPYG00000012724   Transcript: ENSPPYT00000014780
Sequence length 746
Comment pep:known_by_projection chromosome:PPYG2:2a_random:10558734:10565889:-1 gene:ENSPPYG00000012724 transcript:ENSPPYT00000014780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPHWAVWLLAARLWGLGIGAEVWWNLVPRKTVSSGELATVVRRFSQTGIQDFLTLTLTE
QTGLLYVGAREALFAFSMEALELQGAGELYSATLNNFLGTEPIILRNMGPHHSMKTEYLA
FWLNEPHFVGSAYVPESVGSFTGDDDKVYFFFRERAVESDCYAEQVVARVARVCKGDMGG
ARTLQKKWTTFLKARLACSAPNWQLYFNQLQAMHTLQDTSWHNTTFFGVFQAQWGDMYLS
AVCEYQLEEIQRVFEGPYKEYHEEAQKWDRYTDPVPSPRPGSCINNWHRRHGYTSSLELP
DNILNFVKKHPLMEEQVGPRWSRPLLVKKGTNFTHLVADRVTGLDGATYTVLFIGTGDGW
LLKAVSLGPWVHLIEELQLFDQEPMRSLVLSQSKKLLFAGSHSQLVQLPVADCMKYRSCA
DCVLARDPYCAWSVNTSRCVAVGGHSGSLLIQHVMISDTSGICNLRGGKKVRPTPKNITV
VAGTDLVLPCHLSSNLAHARWTFGGRDLPAEQPGSFLYDARLQALVVMAAQPRHAGAYHC
FSEEQGARLAAEGYLVAVVAGPSVTLEARAPLENLGLVWLAVVALGAVCLVLLLLVLSLR
RRLREELEKGAKATERTLVYPLELPKEPTSPPFRPCPEPDEKLWDPVGYYYSDGSLKIVP
GHARCQPGGGPPSPPPGIPGQPLPSPTRLHLGGGRNSNANGYVRLQLGGEDRGLFGHPLP
ELADELSPSTQQRQPLPDSNPEESSV
Download sequence
Identical sequences H2P762
ENSPPYP00000014202 9600.ENSPPYP00000014202 ENSPPYP00000014202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]