SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014214 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014214
Domain Number 1 Region: 65-130
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.15e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014214   Gene: ENSPPYG00000012737   Transcript: ENSPPYT00000014793
Sequence length 206
Comment pep:novel chromosome:PPYG2:2a_random:13625130:13630396:-1 gene:ENSPPYG00000012737 transcript:ENSPPYT00000014793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPAPGALDPRAAPLALLGAPQAEVLEDVLREQFGPLPQLAAVCRLKRLPSGGYSSTENL
QLVLERRRVANAKERERIKNLNRGFARLKALVPFLPQSRKPSKVDILKGATEYIQVLSDL
LEGAKDSKKQDPDEQSCSNNTSEPHISSARQLSRNITQHISCAFGLKNEEEGPWADGGSG
EPAHTCHQSVMSTTEIISPTRSLVKY
Download sequence
Identical sequences H2P774
ENSPPYP00000014214 ENSPPYP00000014214 9600.ENSPPYP00000013739 9600.ENSPPYP00000014214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]