SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014274 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014274
Domain Number 1 Region: 416-515
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014274   Gene: ENSPPYG00000012792   Transcript: ENSPPYT00000014855
Sequence length 516
Comment pep:known_by_projection chromosome:PPYG2:2b:15544311:15601347:-1 gene:ENSPPYG00000012792 transcript:ENSPPYT00000014855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNKKILKEDELLSETQQTAFHQIAMEPFEINGKVRFPNNGIDQKCSLSASEIRKNAVGW
GPVLNLQARLRVLEMYFLNDTLAAEDSLSFSLLQSTHPGEHLAQGASRLQVLQAQLTWVR
VSHEHLLQRVDNFTQNPGMFGIKGEQGAPGLQGHKGAMGMPGAPGPPGPPAEKGAKGAVG
RDGATGPPGPQGPPGVKGEAGFQGPQGAPGKQGATGTPGPQGEKGSKGDGGLIGPKGETG
TKGDKGDLGLPGSKGDRGMKGDTGVMGPPGAQGSKGDSGRPGPPGLAGFPGAKGDQGQPG
LQGVPGPPGAVGHPGAKGEPGSAGSPGRAGLPGSPGSPGAAGLKGSKGDTGLQGQQGRKG
ESGVPGPAGVKGEQGSPGLAGPKGAPGPAGQKGDRGVTGSSGEQGVKGEKGERGENSVSV
RIVGSSNRGRAEVYYSGTWGTICDDEWHNSDATVFCRMLGYSKGRALYKVGAGTGQIWLD
NVQCRGMESTLWSCSKNSWGYHDCSHEEDAGVECSI
Download sequence
Identical sequences H2P7D1
ENSPPYP00000014274 9600.ENSPPYP00000014274 ENSPPYP00000014274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]