SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014409 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014409
Domain Number 1 Region: 3199-3463
Classification Level Classification E-value
Superfamily YWTD domain 1.12e-52
Family YWTD domain 0.00000312
Further Details:      
 
Domain Number 2 Region: 396-657
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-45
Family YWTD domain 0.00000838
Further Details:      
 
Domain Number 3 Region: 711-963
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-43
Family YWTD domain 0.0000196
Further Details:      
 
Domain Number 4 Region: 1438-1699
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-43
Family YWTD domain 0.0000108
Further Details:      
 
Domain Number 5 Region: 2389-2638
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-37
Family YWTD domain 0.0000171
Further Details:      
 
Domain Number 6 Region: 4055-4326
Classification Level Classification E-value
Superfamily YWTD domain 1.19e-36
Family YWTD domain 0.0000293
Further Details:      
 
Domain Number 7 Region: 1746-2012
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-36
Family YWTD domain 0.0001
Further Details:      
 
Domain Number 8 Region: 2065-2335
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-36
Family YWTD domain 0.0000271
Further Details:      
 
Domain Number 9 Region: 305-385,650-706
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.18e-16
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 10 Region: 1353-1430,1691-1738
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000188
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 11 Region: 2735-2776
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000124
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 1065-1103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 13 Region: 3144-3192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000053
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 14 Region: 2987-3028
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 15 Region: 3627-3666
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000759
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 16 Region: 1147-1184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000995
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 17 Region: 2857-2896
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000122
Family LDL receptor-like module 0.00059
Further Details:      
 
Domain Number 18 Region: 1265-1306
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 19 Region: 3026-3066
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 20 Region: 3510-3546
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 21 Region: 3718-3755
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 3069-3109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 23 Region: 103-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 24 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 25 Region: 3758-3795
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000106
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 26 Region: 2699-2742
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 27 Region: 3793-3833
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 28 Region: 2904-2939
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 29 Region: 182-217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 30 Region: 1106-1143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 31 Region: 1023-1060
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 32 Region: 3841-3876
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 33 Region: 216-256
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 34 Region: 3585-3629
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 35 Region: 1186-1224
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 36 Region: 3111-3159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000594
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 37 Region: 1229-1265
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 38 Region: 3926-3962
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000109
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 39 Region: 65-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000115
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 40 Region: 3547-3588
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 41 Region: 2820-2859
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 42 Region: 264-300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 43 Region: 1310-1346
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000681
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 44 Region: 3882-3920
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000798
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 45 Region: 2018-2067
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000893
Family EGF-type module 0.023
Further Details:      
 
Domain Number 46 Region: 2943-2986
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 47 Region: 4007-4041
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 48 Region: 3681-3714
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000432
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 49 Region: 146-180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 50 Region: 4381-4414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000465
Family EGF-type module 0.02
Further Details:      
 
Domain Number 51 Region: 2783-2817
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000982
Family LDL receptor-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000014409
Domain Number - Region: 3969-4008
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000123
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 2341-2385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000262
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 979-1019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00442
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 3468-3529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0105
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 4335-4360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0138
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014409   Gene: ENSPPYG00000012910   Transcript: ENSPPYT00000014995
Sequence length 4512
Comment pep:known_by_projection chromosome:PPYG2:2b:59199541:59416579:-1 gene:ENSPPYG00000012910 transcript:ENSPPYT00000014995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRGWAAVACTLLLALVACLAPASGQECDSAHFRCGSGHCIPADWRCDGTKDCSDDADEI
GCAVVTCQQGYFKCQSEGQCIPNSWVCDQDQDCDDGSDERQDCSQSTCSSHQITCSNGQC
IPSEYRCDHVRDCPDGTDENDCQYPTCEQLTCDNGACYNTSQKCDWKVDCRDSSDEINCT
EICLHNEFSCGSGECIPRAYVCDHDNDCQDGSDEHACNYPTCGGYQFTCPSGRCIYQNWV
CDGEDDCKDNGDEDGCESSPHDVHKCSPREWSCPESGRCISIYKVCDGILDCPRREDENS
TTTGKYCSTTLCSALNCQYQCHETPYGGACFCPPGYIINHNDSRTCVEFDDCQIWGICDQ
KCESRPGHHLCHCEEGYILERGQYCKANDSFGEASIIFSNGRDLLIGDIHGRSFRILVES
QNRGVAVGVAFHYHLQRVFWTDTVQNKVFSVDINGLNIQEVLNVSVETPENLAVDWVNNK
IYLVETKVNRIDMVNLDGSYRVTLITENLGHPRGIAVDPTVGYLFFSDWESLSGEPKLER
AFMDGSNRKDLVKTKLGWPAGVTLDMISKRVYWVDSRFDYIETVTYDGIQRKTVVHGGSL
IPHPFGISLFEGQVFFTDWTKMAVLKANKFTETNPQVYYQASLRPYGVTVYHSLRQPYAT
NPCKDNNGGCEQVCVLSHRTDNDGLGFRCKCTFGFQLDTDERRCIAVQNFLIFSSQVAIR
GIPFTLSTQEDVMVPVSGNPSFFVGIDFDAQDSTIFFSDMSKHMIFKQKIDGTGREILAA
NRVENVESLAFDWISKNLYWTDSHYKSIGVMRLADKTRRTVVQYLNNPRSVVVHPFAGYL
FFTDWFRPAKIMRAWSDGSHLLPVINTTLGWPNGLAIDWAASRLYWVDAYFDRIEHSTFD
GLGRRRLGHIEQMTHPFGLAIFGEHLFFTDWRLGAIIRVRKADGGEMTVIRSGIAYILHL
KSYDVNIQTGSNACNQPTHPNGDCSHFCFPVPNFQRVCGCPYGMRLASNHLTCEGDPTNE
PPTEQCGLFSFPCKNGRCVPNYYRCDGVDDCHDNSDEQLCGTLNNTCSSSAFTCGHGECI
PAHWRCDKRNDCVDGSDEHNCPTHAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDE
KNCNSTGTCQPSQFNCPNHRCIDLSFVCDGDKDCVDGSDEVGCVLNCTASQFKCASGDKC
ISVTNRCDGVFDCTDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGS
DEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCL
GHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFL
LANDSKTCEDIDECDIPGSCSQHCYNMRGSFRCSCDTGYMLESDGRTCKVTASESLLLLV
ASQNKIIADSVTSQVHNIYSLVENGSYIVAVDFDSISGRIFWSDATQGKTWSAFQNGTDR
RVVFDSSIILTETIAIDWVGRNLYWTDYALETIEVSKIDGSHRTVLISKNLTNPRGLALD
PRMNEHLLFWSDWGHHPRIERASMDGSMRTVIVQDKIFWPCGLTIDYPNRLLYFMDSYLD
YMDFCDYSGHHRRQVIASDLIIRHPYALTLFEDSVYWTDRATRRVMRANKWHGGNQSVVM
YNIQWPLGIVAVHPSKQPNSVNPCAFSRCSHLCLLSSQGPHFYSCVCPSGWSLSPDLLNC
LRDDQPFLITVRQHIIFGISLNPDVKSNDAMVPIAGIQNGLDVEFDDTEQYIYWVENPGE
IHRVKTDGTNRTVFASISMVGPSMNLALDWISRNLYSTNPRTQSIEVLTLHGDIRYRKTL
IANDGTALGVGFPIGITVDPARGKLYWSDQGTDSGVPAKIASANMDGTSVKTLFTGNLEH
LECVTLDIEEQKLYWAVTGRGVIERGNVDGTDRMILVHQLSHPWGIAVHDSFLYYTDEQY
EVIERVDKATGANKIVLRDNVPNLRGLRVYHRRNAAESSNGCSNNMNACQQICLPVPGGL
FSCACATGFKLNPDNRSCSPYNSFIVVSMLSAIRGFSLELSDHSETMVPVAGQGRNALHV
DVDVSSGFIYWCDFSSSVASDNAIRRIKPDGSSLTNIVTHGIGENGVRGIAVDWVAGNLY
FTNAFVSETLIEVLRINTTYRRVLLKVTVDMPRHIVVDPKNRYLFWADYGQRPKIERSFL
DCTNRTVLVSEGIVTPRGLAVDRSDGYVYWVDDSLDIIARIRINGENSEVIRYGSRYPTP
YGITVFENSIIWVDRNLKKIFQASKEPENTDPPTVIRDNINWLRDVTIFDKQVQPRSPAE
VNNNPCLENNGGCSHLCFALPGLHTPKCDCAFGTLQSDGKNCAISTENFLIFALSNSLRS
LHLDPENHSPPFQTINVERTVMSLDYDGVSDRIYFTQNLASGVGQISYVTLSSGIHTPTV
VASGIGTADGIAFDWITRRIYYSDYLNQTINSMAEDGSNRTVIARVPKPRAIVLDPCQGY
LYWADWDTHAKIERATLGGNFRVPIVNSSLVMPSGLTLDYEEDLLYWVDASLQRIERSTL
TGMDREVIVNAAVHAFGLTLYGQYIYWTDLYTQRIYQANKYDGSGQIAMTTNLLSQPRGI
NTVVKNQRQQCNNPCEQFNGGCSHICASGPNGAECQCPHEGNWYLANNRKHCIVDNGERC
GASSFTCSNGRCISEEWKCDNDNDCGDGSDEMESVCALHTCSPTAFTCANGRCVQYSYRC
DYYNDCGDGSDEAGCLFRDCNATTEFMCNNRRCIPREFICNGVDNCHDNNTSDEKNCPDR
TCQSGYTKCHNSNICIPRVYLCDGDNDCGDNSDENPTYCTTHTCSSSEFQCTSGRCIPQH
WYCDQETDCFDASDEPASCGHSERTCLADEFKCDGGRCIPSEWICDGDNDCGDMSDEDER
HQCQNQNCSDSEFLCVNDRPPDRRCIPQSWVCDGDVDCTDGYDENQNCTRRTCSENEFTC
GYGLCIPKIFRCDRHNDCGDYSDERGCLYQTCQQNQFTCQNGRCISKTFVCDEDNDCGDG
SDELMHLCHTPEPTCPPHEFKCDNGRCIEMMKLCNHLDDCLDNSDEKGCGINECHDPSIS
GCDHNCTDTLTSFYCSCHPGYKLMSDKRTCVDIDECTETPFVCSQKCENVIGSFICKCAP
GYLREPDGKTCRQNSNIEPYLIFSNRYYLRNLTIDGYFYSLILEGLGNVVALDFDRVEKR
LYWIDTQRQVIERMFLNKTNKETIINHRLPAAESLAVDWVSRKLYWLDARLDGLFVSDLN
GGHRLMLAQHCVDANNTFCFDNPRGLALHPQYGYIYWADWGHRAYIGRIGMDGTNKSVII
STKLEWPNGITIDYTNDLLYWADAHLGYIEYSDLEGHHRHMVYDGALPHPFAITIFEDTI
YWTDWNTRTVEKGNKYDGSNRQTLVNTTHRPFDIHVYHPYRQPIVSNPCGTNNGGCSHLC
LIKPGGKGFTCECPDDFRTLQLSGSTYCMPMCSSTQFLCANNEKCIPIWWKCDGQKDCSD
GSDELALCPQRFCRLGQFQCNDGNCTSPQTLCNAHQNCPDGSDEDRLLCENHHCDSNEWQ
CANKRCIPESWQCDTFNDCEDNSDEDSSHCASRTCRPGQFRCANGRCIPQAWKCDVDNDC
GDHSDEPIEECMSSAHLCDNFTEFSCKTNYRCIPKWAMCNGVDDCRDNSDEQGCEERTCH
PVGDFRCKNHHCIPLRWQCDGQNDCGDNSDEENCAPRECTESEFRCVNQQCIPSRWICDH
YNDCGDNSDERDCEMRTCHPEYFQCTSGHCVHSELKCDGTADCLDASDEADCPTRFPDGA
YCQATMFECKNHVCIPPYWKCDGDDDCGDGSDEELHLCLDVPCNSPNRFRCDNNRCIYGH
EVCNGVDDCGDGTDETEEHCRKPTPKPCTEYEYKCGNGHCIPHDNVCDDADDCGDWSDEL
GCNRGKERTCAENICEQNCTQLNEGGFICSCTAGFETNVFDRTSCLDINECEQFGTCPQH
CRNTKGSYECVCADGFTSMSDHPGKRCAAEGSSPLLLLPDNVRIRKYNLSSERFSEYLQD
EEYIQAVDYDWDPEDIGLSVVYYTVRGEGSRFGAIKRAYIPNFESGHNNLVQEVDLKLKY
VMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGRYRKWLISTDLDQPAAIAVNPKLGLMF
WTDWGKEPKIESAWMNGENRNILVFEDLGWPTGLSIDYLNNDRIYWSDFKEDVIETIKYD
GTDRRVIAKEAMNPYSLDIFEDQLYWISKEKGEVWKQNKFGQGKKEKTLVVNPWLTQVRI
FHQLRYNKSVPNLCKQICSHLCLLRPGGYSCACPQGSSFIEGSTTECDAAIELPINLPPP
CRCMHGGNCYFDETDLPKCKCPSGYTGKYCEMAFSKGISPGTTAVAVLLTILLIVVIGAL
AIAGFFHYRRTGSLLPALPKLPSLSSLVKPSENGNGVTFRSGADLNMDIGVSGFGPETAI
DRSMAMVSMVSK
Download sequence
Identical sequences H2P7R3
ENSPPYP00000014409 ENSPPYP00000014409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]