SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014461 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014461
Domain Number 1 Region: 354-414
Classification Level Classification E-value
Superfamily Leucine zipper domain 2.08e-18
Family Leucine zipper domain 0.0000413
Further Details:      
 
Domain Number 2 Region: 19-49
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000033
Family Classic zinc finger, C2H2 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014461   Gene: ENSPPYG00000012951   Transcript: ENSPPYT00000015048
Sequence length 505
Comment pep:known_by_projection chromosome:PPYG2:2b:65194755:65289805:-1 gene:ENSPPYG00000012951 transcript:ENSPPYT00000015048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIVMAPSSQSQPSGS
Download sequence
Identical sequences A0A096NZ79 A0A0D9RPV5 A0A2I2Y993 A0A2I3GRA9 A0A2I3RGD4 A0A2K5HJI3 A0A2K5KKL9 A0A2K5S782 A0A2K6CZS6 A0A2K6TED0 G7N8C8 G7PKV5 H2P7W4 P15336 U3DG35
ENSPTRP00000021635 9598.ENSPTRP00000021635 9600.ENSPPYP00000014461 9606.ENSP00000264110 ENSPANP00000018400 ENSP00000264110 NP_001243019.1.87134 NP_001243019.1.92137 NP_001871.2.87134 NP_001871.2.92137 XP_003253787.1.23891 XP_003253790.1.23891 XP_007963607.1.81039 XP_007963608.1.81039 XP_009236125.1.23681 XP_010350147.1.74449 XP_011742209.1.29376 XP_011742210.1.29376 XP_011742211.1.29376 XP_011742213.1.29376 XP_011742214.1.29376 XP_011799389.1.43180 XP_011902448.1.92194 ENSP00000264110 ENSP00000376327 gi|22538422|ref|NP_001871.2| ENSPPYP00000014461 ENSNLEP00000007214 ENSNLEP00000023548 ENSPPYP00000014461 HR4498 ENSP00000264110 ENSP00000376327 ENSNLEP00000007214 ENSPTRP00000021635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]