SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014491 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014491
Domain Number 1 Region: 355-662
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.52e-111
Family PDEase 0.0000000886
Further Details:      
 
Domain Number 2 Region: 132-334
Classification Level Classification E-value
Superfamily GAF domain-like 9.81e-43
Family GAF domain 0.00016
Further Details:      
 
Domain Number 3 Region: 53-148
Classification Level Classification E-value
Superfamily GAF domain-like 1.55e-25
Family GAF domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014491   Gene: ENSPPYG00000012972   Transcript: ENSPPYT00000015078
Sequence length 681
Comment pep:known_by_projection chromosome:PPYG2:2b:67834381:68339195:-1 gene:ENSPPYG00000012972 transcript:ENSPPYT00000015078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKQARRPSFQNVLCATQWKKVKNTRLVQISGASLAEKQEKHQDFLIQRQTKTKDRRFND
EIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKTPEGAPFTEDDEKVMQMYLPFCGIAI
SNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLLED
IESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVASTGLPVNISD
AYQDPRFDAEADQISGFHIRSVLCVPIWNNNHQIIGVAQVLNRLDGKPFDDADQRLFEAF
VIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANIPLVSELAIDD
IHFDDFSLDVDVMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRMVLYHNWRHAF
NVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSGSALAQLYGTS
ATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLYFERRTEFFEL
VSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFGDRERLELKLT
PSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNMKLKPMLDSVATNRSKWEELHQKR
LLASTASSSPASVIVAKEDRN
Download sequence
Identical sequences H2P7Z3
ENSPPYP00000014491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]