SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014509 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014509
Domain Number 1 Region: 34-465
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 7.46e-78
Family Integrin alpha N-terminal domain 0.000000617
Further Details:      
 
Domain Number 2 Region: 465-622
Classification Level Classification E-value
Superfamily Integrin domains 1.41e-34
Family Integrin domains 0.0019
Further Details:      
 
Domain Number 3 Region: 626-764
Classification Level Classification E-value
Superfamily Integrin domains 2.33e-28
Family Integrin domains 0.0036
Further Details:      
 
Domain Number 4 Region: 772-959
Classification Level Classification E-value
Superfamily Integrin domains 7.32e-27
Family Integrin domains 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014509   Gene: ENSPPYG00000012988   Transcript: ENSPPYT00000015097
Sequence length 1032
Comment pep:known_by_projection chromosome:PPYG2:2b:71855707:71944906:1 gene:ENSPPYG00000012988 transcript:ENSPPYT00000015097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWEARREPGPRRAAVRETVMLLLCLGVPTGCPYNVDTESALLYQGPPNTLFGYSVVLHS
HGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGMPPDLRTELSKRI
APCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLD
KQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNAMEINLVG
SDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLRGAIYIYNGRADGISSTFSQRIEG
LQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVEASLSHPESVN
RTKFDCVENGWPSVCMDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGT
SDVITGSIQVSSRVANCRTHRAFMRKDVRDILTPIQIEAAYHLGPHVISKRSTEEFPPLQ
PILQQKKEKDIIKKTINFARFCAHENCSADLQVSAKIGFLKPHENKTYLAVGSMKTLMLN
VSLFNAGDDAYETTLHVKLPVGLYFIKILELEDKQINCEVTDNSGMVQLDCSIGYIYVDH
LSSIDISFLLDVSSLSRAEEDLNITVHATCENEGEMDNLKHSRVTVAIPLKYEVKLTVHG
FVNPTSFVYGSNDENEPETCMVEKMNLTFHVINTGNSMAPNVSVEIMVPNSFSPQTDKLF
NILDVQTTTGECHFENYQRVCALEQQKSAMQTLKGIVQFLSKTDKRLLYCIKADPHCLNF
LCNFGKMESGKEASVHIQLEGRPTILEMDETSALKFEIRATGFPEPNPRVIELNKDENVV
HVLLEGLHHQRPKRYFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRD
SWSYINSKSNDD
Download sequence
Identical sequences H2P811
ENSPPYP00000014509 9600.ENSPPYP00000014509 XP_002812692.1.23681 ENSPPYP00000014509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]