SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014531 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014531
Domain Number 1 Region: 117-484
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.62e-83
Family Integrin alpha N-terminal domain 0.00000000000202
Further Details:      
 
Domain Number 2 Region: 762-990
Classification Level Classification E-value
Superfamily Integrin domains 2.35e-68
Family Integrin domains 0.00000000138
Further Details:      
 
Domain Number 3 Region: 485-633
Classification Level Classification E-value
Superfamily Integrin domains 2.46e-41
Family Integrin domains 0.0000000571
Further Details:      
 
Domain Number 4 Region: 635-754
Classification Level Classification E-value
Superfamily Integrin domains 3.19e-31
Family Integrin domains 0.00000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014531   Gene: ENSPPYG00000013007   Transcript: ENSPPYT00000015120
Sequence length 1041
Comment pep:known_by_projection chromosome:PPYG2:2b:77311503:77401180:1 gene:ENSPPYG00000013007 transcript:ENSPPYT00000015120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERRSWREARGRLRCCPRPARSAPRVPGGRSEAQPSCLPRSCPGLAEKRAAGKFGRAQAAG
RGHWAPRWGGGRWLPLPAWRPARTSTMASPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLD
VDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSST
RRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREP
VGTCFLQDGTKTVEYAPCRSRQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDS
YLGYSVAVGDFNGDGIDMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQ
VSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVY
IFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAIL
YRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQ
VELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTP
ITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQDQKKIYIGDDNPLTLIVKAQNQGEG
AYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGL
RFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHIFLPI
PNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDID
GPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVA
QCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLP
IEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPP
QEEQEREQLQPHENGEGNSET
Download sequence
Identical sequences H2P832
ENSPPYP00000014531 9600.ENSPPYP00000014531 ENSPPYP00000014531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]