SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014543 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014543
Domain Number 1 Region: 190-336
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-23
Family DNA gyrase/MutL, second domain 0.00049
Further Details:      
 
Domain Number 2 Region: 16-199
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.88e-19
Family DNA gyrase/MutL, N-terminal domain 0.0012
Further Details:      
 
Domain Number 3 Region: 571-642
Classification Level Classification E-value
Superfamily HMG-box 1.57e-18
Family HMG-box 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014543   Gene: ENSPPYG00000013018   Transcript: ENSPPYT00000015132
Sequence length 930
Comment pep:known_by_projection chromosome:PPYG2:2b:80544778:80633438:1 gene:ENSPPYG00000013018 transcript:ENSPPYT00000015132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQLPAATVRLLSSSQIITSVVSVVKELIENSLDAGATSIDVKLVSVLENPNTFKTKNRG
WTHTSNVCIFYKYCWPVAYSCNSKEYYKRTGHKLLVLLDVFFPQVLITTRTAADNFSTQY
VLDGSGHILSQKPSHLAQGTTVTALRLFRNLPVRKQFYSTAKKCKDEIKKIQDLLMSYGI
LKPDLRIVFVHNKAVIWQKSRVSDHKMALMSVLGTAVMSNMESFQYHSEESQIYLSGFLP
KCDADHSFTSLSTPERSFIFINSRPVHQKDILKLIRHHYNLKCLKESTRLYPVFFLKIDV
PTADVDVNLTPDKSQVLLQNKESVLIALENLMTTCYGPLLSTNSYENNKTDVSAADIVLS
KTAETDVLFNKMESSGKNYSNVDTSIIPFQNDMHNDESGKNNDDCLNHQISIGDFGYGHC
SSEISNVDKNTKNAFQDISMSNVSWENTQTEYSKTCFVGSIKHTQSENGNKDHIDESGEN
EEEAGLENSLEISADEWSRGNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPSPEQTNL
NEDPCNKKSNVIDNKSGKVTAYDLLSNRVVKKPMSASALFVQDHRPQFLIENPKTSLEDA
TLQIEELWKTLSEEEKLKYEEKATKDLERYNNQMKRAIEQESQISLKDGRKKIKPTSAWN
LAQKHKLKTSLSNQPKLDELLQSQIEKRSQNIKMVQIPFSMKNLKINFKKQDKVDLEEKN
EPCLIHNLRFPDAWLMTSKTEVMLLNPYRVEEALLFKRLLENHKLPAEPLEKPIMLTESL
FNGSHYLDVLYKMTADDQRYSGSTYLSDPRLTANGFKIKLIPGVSITENYLEIEGMANCL
PFYGVADLKEILNAILNKNAKEVYECRPRKVISYLEGEAVRLSRQLPMYLSKEDIQDIIY
RMKHQFGNEIKGCVHGRPFFHHLTYLPETT
Download sequence
Identical sequences H2P843
ENSPPYP00000014543 9600.ENSPPYP00000014543 ENSPPYP00000014543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]