SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014624 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000014624
Domain Number - Region: 27-72
Classification Level Classification E-value
Superfamily SRP19 0.0127
Family SRP19 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014624   Gene: ENSPPYG00000013086   Transcript: ENSPPYT00000015215
Sequence length 115
Comment pep:novel chromosome:PPYG2:2b:94057452:94057796:-1 gene:ENSPPYG00000013086 transcript:ENSPPYT00000015215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKKRSNNGRAKKGRGHVQPIRCTNCARRVPKDKAIKKFVIRNIVEAAAVRDISEVSVFD
AYVLPKLYVKLHYCVSCAIHSTVVRNRSREARKDRTPPPRFRPAGAAPRPPPKPM
Download sequence
Identical sequences H2P8B9
XP_009236274.1.23681 9600.ENSPPYP00000014624 ENSPPYP00000014624 ENSPPYP00000014624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]