SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014650 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000014650
Domain Number - Region: 5-36
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0298
Family HkH motif-containing C2H2 finger 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014650   Gene: ENSPPYG00000013109   Transcript: ENSPPYT00000015242
Sequence length 1092
Comment pep:known_by_projection chromosome:PPYG2:2b:97807207:97834370:1 gene:ENSPPYG00000013109 transcript:ENSPPYT00000015242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKRQGYCSYCRVQYNNLEQHLFSAQHRSLTRQSRRQICTSSLMERFLQDVLQHHPYHCQ
ESSSTQDETHVNTGSSSEVVHLDDAFSEEEEEEEDEDKVEDEDATEERPSEVSEPIEELH
CRPHKSQEGTQESVRPSVIQKLEKGQQQPLEFVHKIGAGVKKCNLVDIGQATNNGSNLVR
PPVICNAPASCLPESSNDRPVTANTTSLPPAAHLDSVSKCDPNKVEKYVEQPDGASRNPV
PSSHVETSSFSYQKHKESNRKSLRMNSDKLVLWKDVKSQGKTLSAGLKFHERMGTKGSLR
VKSPSKLAVNPNKTDMPSNKGIFEDTIAKNHEEFFSNMDCTQEEKHLVFNKTAFWEQKCS
VSSEMKFDCSSLQSASDQPQETAQDLNLWKEERIDQEDNYESRGSEMSFDCSSSFHSLTD
QSKVSAKEVNLSKEVRTDVQYKNNKSYVSKISSDCDDILHLITNQSQMIVKEISLQNARH
ISLVDQSYESSSSETNFDCDASPQSTSDYPQQSVTEVNLPKEVHIGLVDKNYGSSSSEVS
ADSVFPLQSVVDRPPVAVTETKLRKKAHTGLVDNYGSSCSETSFDCDVSLESVVDHPQLT
VKGRNLKGRQVHLKHKKRKPSSAKAHLDCDVSLGTVADESQRAVEKINLLKEKNADLMDM
NCESHGPEMGFQADAQLADRSQVAEIEPQKVDVDLENKSVRSSRSSLSSDSPASLYHSAH
DEPQEALDEVNLKELNIDMEVKSYDCSSSELTFDSDPPLLSVTEQSHLDAEGKERHIDLE
DESCESDSSEITFDSDIPLYSVIDQPQVAVYEEETVDLESKSNESCVSEITFDSDIPLHS
GNDHPEVAVKEVIQKEEYIHLERKNDEPSGSEISSDSHAPLHSVTNSPEVAVKKLNPQKE
EQVHLENKENEPTDSEVSLDYNIIFHSVTGHSEDPIKEISLHTKEHMYLENKSVFETSLD
SDVPLQAATHKPEVIVKETWLQREKHAEFQDRSTEFSSSKTSLDSGVPHYSVTEPQVAVN
KINRKKQYVLENKNDKCSGSEIILDSNVPPQSMTDQPQLAFLKEKHVNLKDKNSKSGDSK
ITFDSAQLQEAV
Download sequence
Identical sequences H2P8E4
ENSPPYP00000014650 ENSPPYP00000014650 9600.ENSPPYP00000014650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]