SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014697 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014697
Domain Number 1 Region: 243-545
Classification Level Classification E-value
Superfamily SPOC domain-like 3.34e-96
Family Ku80 subunit middle domain 0.0000000000348
Further Details:      
 
Domain Number 2 Region: 6-241
Classification Level Classification E-value
Superfamily vWA-like 1.75e-50
Family Ku80 subunit N-terminal domain 0.00000000111
Further Details:      
 
Domain Number 3 Region: 559-709
Classification Level Classification E-value
Superfamily C-terminal domain of Ku80 1.24e-48
Family C-terminal domain of Ku80 0.000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014697   Gene: ENSPPYG00000013152   Transcript: ENSPPYT00000015292
Sequence length 732
Comment pep:known chromosome:PPYG2:2b:107881561:107978763:1 gene:ENSPPYG00000013152 transcript:ENSPPYT00000015292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFG
TDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQH
ETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGD
GTFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKI
ERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDD
DETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQ
VLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLV
YVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTT
KIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLI
EAKKKDQVTAQDIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRV
LVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSMDCIRAFREEAIKFSEEQRFNNFLK
ALREKVEVKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFE
EGGDVDDLLDMI
Download sequence
Identical sequences H2P8I9
ENSPPYP00000014697 9600.ENSPPYP00000014697 ENSPPYP00000014697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]