SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014749 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014749
Domain Number 1 Region: 541-646
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000808
Family Ankyrin repeat 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000014749
Domain Number - Region: 120-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0061
Family Classic zinc finger, C2H2 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014749   Gene: ENSPPYG00000013200   Transcript: ENSPPYT00000015346
Sequence length 776
Comment pep:known_by_projection chromosome:PPYG2:2b:111087649:111098292:1 gene:ENSPPYG00000013200 transcript:ENSPPYT00000015346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGADAAGCPLRYSVVTEIVVLQKSGRRPEDLRAAQLPGRLELLLNNFCSAMSPAPDAAPA
PASISLFDLSADAPVLQGLSLVSHAPGEALARAPRTSCSGSGERESPERKLLQGPMDISE
KLFCSTCDQTFQNHQEQREHYKLDWHRFNLKQRLKDKPLLSALDFEKQSSTGDLSSISGS
EDSDSASEEDLQTLDRERATFEKFSRPQGFYPHRVLFQNAQGQFLYAYRCVLGPHQDPPE
EAKLLLQNLQSRGPRDCVVLMAAAGHFAGAIFQGREVVTHKTFHRYTVRAKRGTAQGLRD
ARGGPSRSAGANLRRYNEATLYKDVRDLLAGPSWAKALEEAGTILLRAPRSGRSLFFGGK
GAPLQRGDPRLWDIPLATRRPTFQELQRVLHKLTTLHVYEEDPREAVRLHSPQTHWKTIR
EERKKPTEEEIRKICSDEKEALGQNEESPKQGSGSEGEDGFQVELELVELTMGTLDLRES
EVLPKRRRRKRNKKEKSRDQETGAHRTLLQQTQEEEPSTQSSQAVVAPLGPSLDEAKAPG
QPELWNALLAACRAGDVGVLKLQLAPSPADPRVLSLLSAPLGSGGFTLLHAAAAAGRGSV
VRLLLEAGADPIVQDSRARPPYTVAADKSTRNEFRRFMEKNPDAYDYNKAQVPGPLTPEM
EARQATRKREQKAARRQREERQQRHQEQEEREREEQRRFAALSDREKRALAAECRLAAQL
GAPTSPIPDSAIVNTRRCWSCGASLQGLTPFHYLDFSFCSTRCLQDHRRQAGRPSS
Download sequence
Identical sequences H2P8N7
ENSPPYP00000014749 ENSPPYP00000014749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]